Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 8

Class II lantipeptide/class III/IV lantipeptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf11210 A
orf_1968 LanM
orf11234 LanM
orf_1972 LanKC

Cluster:

    

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Propeptides: 0
  • Subgraph combinations: 1
  • Total combinatorial plans: 2 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf11210

Domain Start End Score
Putative lantipeptide precursor 0 60 N/A

Detection: potential coding sequence
Start: 2317030 | End: 2317213 | Frame: +

Sequence: show VGRWKRCRDSSTVGSRRARKPATSPVSSTRTACAASGPSGSKMPSRAWLKPRSSPAISS (hide)

Domain analysis:

Biosynthetic assembly:

A

orf_1968

Domain Start End Score
Lantipeptide fused dehydratase/cyclase 4 840 1155.0

Detection: predicted by Prodigal
Start: 2320567 | End: 2323630 | Frame: +

Sequence: show MAEKNLIDRGTSRRPAPAASAVSVASLHNAASEPWWLPGVVGGSTSGEPAWAAFAREAVAAAPRDVVVADRAYPGLSGFGPIVAPFVEAAAGRLRDALAGGEPEGDGAPVLADFRRQLTRRLARIAARTLVTELHEARRLGRLSGEGPEERFRDFVALTARRDGLDRLVTGYPVLARLLATACLNTASAFAELVARLAADRHLLAPAGVFGNPDGGPGGLGPAAGPGALTGVEAGAGDSHRGGRSVMLLRFADGTRLVYKPRPLAAHRHFNSLVEWFGSLPGAPELRVLRVLDRGDYGWAEFVAERPCASGAETRQFYRRQGALLALLHALDGTDLHHENLIACGPHPVLVDVETLFHPPLGPARSADPAARALHGSVHRVGLLPQLLVGDTTALDMSAIGGGRAASSPIETADWAEAGTDRMRLVRRAGRFTESANRPRLGAEAADPSAYTEALCDGFRAGYTAIHDHRDEFLAPDGPLRRFAGDEVRVVPRPTWTYTTLLDESTHPDLMRDAAERHRVLSLLRTPILGVPALSGVEDEEIAELWCGDVPVFATRPGSGRLWSGTGRTVTGSAPEGSAPGAVAPTGLARVEAKVRAMDTVDRQDQERIIRTAMVSTSPEPPHRPGPGGRTPSAATAPEPEQLLSAARSVGDQLVSLAYRHEGRTNWIGLELLGERYWRLTPMAADLAGGYTGPALFLAQLAALTGVSRYAEAAREALAPVPGLLDALHGRADELGALGSGAYAGLGGIAYALTEVGTLLGDREVLDQAGPAVRLSCAANAAEDGYGVRGGAAGGLVSLLAVYRATGRPQAWWGAVRCAKRLAAAPVPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGRAGDRRQPRRPAGPGTVRLAGGPLRRAGGQGPARRRQPVPRGVRAARTPRSQRPARPPARRTGRVGTPGRDAGGRGGPGGTAVRDARPRTAPGAAHRPLGHRARTAAGGVPRPDRLRPAPGPLPGPLIHPDLPDETHRC (hide)

Domain analysis:

Biosynthetic assembly:

LanM

orf11234

Domain Start End Score
Lantipeptide fused dehydratase/cyclase 101 231 147.4

Detection: potential coding sequence
Start: 2322896 | End: 2323592 | Frame: +

Sequence: show VRRTRPRTGTGCAAARRAGWSRCSRCTAPPAARRPGGAPCAAPSGWPPPRFPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVALAIADSPDARQDPELSGWLAARSGELAGRAPLADDSLCHGESGLLELLGHSALPALLPGVRAAWVRRAGTLVAAADRAGPLCGTPGHAPHPGLLTGLSGIGHGLLRAGFPDRIGSALLLDPSRA (hide)

Domain analysis:

Biosynthetic assembly:

LanM

orf_1972

Domain Start End Score
Lantipeptide kinase/cyclase (LanKC or LanL) 6 852 841.7

Detection: predicted by Prodigal
Start: 2329047 | End: 2331669 | Frame: -

Sequence: show MPGIQETQLYCLADRRYYDTPARLPDQETRYPLDTAEPPAGWRRVAGGLWTALLPEDGEPAEQGWKIHVSTVPEEAAQTLRDTAGICLRHRVPFKFLRSEQALLLMSGKYMSRGSAGKFLTLYPPDETALARVLDELTTALSGRPGPYILSDLRIGDAPVYVRYGSFVDRWCRDARGERVPALRHPSGELVPDERGVVFRTPAWVKVPELLRPHLAARAAARDDSFPYTVTEALQFSNAGGIYLARHRETGHRVVLREARPHCGLDAVGDDAVTRLEREHRALTALAGLDCVPEVYGVRTVWEHRFLMTEYVEGPTLLDEIVARFALVRGARTADELAPYAAWVHHVTAQLGDALREIHGRGMRFGDLHPSNIILRPDGRLALVDFEYATELDDEKTPLAGAPGLQAPPGTPGAEADAYALWATWLTMLMPLTEMASHDRVKALSLESWARERYGLAPDAGPARPALLWAAERAVDREREIAALLGGPTPDWAELRARLIAGIHAGATPERRDRLFPGDPKGFATGGTDLAHGAAGVLYALHRVGAPVPAAWTDWLAETARRRDPAAPGGLYDGLPGTAVTLALLGRPDEGRELFARAAEAAHPSPSADLLTGRAGIALAAVRLAGAAPGAPDPELLDTALRTAWDLDCLVRGETGAGGPEAPPSAGLLRGLSGAALLHLELHALTGEEWLLRAARTALYRDSGHCVAMDDGTVQVKDGRRHLLYLDQGSGGFALVARAYLARQEAPSLAGLLPGVRKGCGNEFVREPGLFTGRAGLVATARQLEDEGPAGPEVLASVRNLSWHLVADGDRLLVPGARLRRCSADLATGAAGLLLALHFLAGADTEEAAAPGHGPGGDGHRPHDLLKLLTLG (hide)

Domain analysis:

Biosynthetic assembly:

LanKC