Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 7

Polyketide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_1555 Mal
orf_1556 KSIII
orf_1557 T
orf_1558 KS

Cluster:

orf_1555   

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Error: Unable to generate predicted structure!

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_1555

Domain Start End Score
Acyltransferase+ 5 292 142.6
Malonyl-CoA 41 266 132.9

Detection: predicted by Prodigal
Start: 1880665 | End: 1881583 | Frame: +

Sequence: show MLVLVAPGQGAQTPGFLTPWLDLPGAADRIAAWSDAIGLDLAHYGTKADADEIRDTAVAQPLLVAAGLLSAAALDAASPDVVAGHSVGEITAAALAGVIEDEAALRFVRTRGLGMAEAAAVTETGMAALLGGDPAVTIPHLEKLGLTPANVNGAGQIVAAGTAAQLAALEADKPEGVRRVVALKVAGAFHTHHMAPAVEKLRAAVGDLTVSDPTVRYVSNADGHTVATGTEVIARLVGQVANPVRWDLCMETFQSLGVTALVELSPGGTLTGIAKRALPGVRTLALKTPDDDAARALISEHAGV (hide)

Domain analysis:

Biosynthetic assembly:

Mal

orf_1556

Domain Start End Score
Ketosynthase III 1 343 364.3

Detection: predicted by Prodigal
Start: 1881592 | End: 1882624 | Frame: +

Sequence: show MSKIKPSKGAPYARILGVGGYRPTRVVPNEVILETIDSSDEWIRSRSGIVTRHWASEEETVAAMSIEASGKAIADAGIDPEQIGAVVVSTVSHFKQTPAVATEIAHRIGAGKPAAFDISAGCAGFGYGLTLAKGMVVEGSAEYVLVIGVERLSDLTDLEDRATAFLFGDGAGAVVVGPSQEPAIGPTVWGSEGDKSETIKQTVGWNEFRLGDVSQLPLDSKGEIKFPAITQEGQAVFRWAVFEMAKVAQQALDAAGIAPEDLDVFIPHQANMRIIDSMVKTLKLPEHVTVARDIESTGNTSAASIPLAMERLLATGQAKSGDTALVIGFGAGLVYAATVVTL (hide)

Domain analysis:

Biosynthetic assembly:

KSIII

orf_1557

Domain Start End Score
Thiolation 10 77 57.9

Detection: predicted by Prodigal
Start: 1882687 | End: 1882936 | Frame: +

Sequence: show MAATQEEIVKGLAEIVNEIAGIPEEDVELGKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDEDVKNLKTVGDAADYLKHQG (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_1558

Domain Start End Score
Ketosynthase+ 65 420 152.2
1_FabF-Streptomyces-FAS_FAS_ 582.0
1_FabB-Streptomyces-FAS_FAS_ 582.0
1_FabF-Bacillus-FAS_FAS_ 290.0
1_A-74528_type2-alpha_Mal 241.0
1_FabF-Ecoli-FAS_FAS_ 241.0
1_mithramycin_type2-alpha_Mal 239.0
1_pradimicin_type2-alpha_Mal 237.0
1_urdamycin_type2-alpha_Mal 235.0
1_medermycin_type2-alpha_Mal 234.0
1_lysolipin_type2-alpha_Mal 227.0

Detection: predicted by Prodigal
Start: 1883012 | End: 1884275 | Frame: +

Sequence: show MNSTNRTVVVTGIGATTPLGGDSASTWEGLMAGRSGVKPLEGERFADLPVRIAALAAVDPGEVLPRPLARKLDRSAQFALIAAREAWADAGFTAKAGEDEAIAPERLGSVIASGIGGVITLLDQYDVLKEKGVRRVSPHTVPMLMPNGPAANVGLEVNAQAGVHTPVSACASGAEAIGYAVEMIRTGRADVVVAGGTEAAIHPLPIAAFANMMAMSKNNDEPEKASRPYDTGRDGFVLGEGAGVVILESAEHAAKRGAKVYCEVLGQGLSADAHHIAQPEPTGRGIAAAMQNLLDSSDLKPSEVVHLNAHATSTPQGDIAEVKALRKVLGDDLDHVAISATKSMTGHLLGGAGGIETVATVLALHHRTAPPTINVDDLDEAIEADIVRGEPRALPEGPIAAINNSFGFGGHNVVLAFRS (hide)

Domain analysis:

Biosynthetic assembly:

KS