Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 5

Nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_648 AMR271
orf_657 AmT
orf_658 PolP
orf_661 SbnA
orf_662 DdaB
orf_663 DapT
orf_664 TE
orf_666 C*AsnTEThrTESerTCTEThrTEThrT
orf_667 CSerTEGlyTCGlyNMTTE

Cluster:

     orf_663 orf_666orf_667

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 1
    (maximum 500)
  • Subgraph combinations: 1
  • Total combinatorial plans: 100 (maximum 1,000)
  • Scaffolds generated: 8 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_648

Domain Start End Score
Multidrug MFS transporter 3 446 374.3

Detection: predicted by Prodigal
Start: 870144 | End: 871689 | Frame: -

Sequence: show MISTEKNPDTTDAVRRPGRWIALAVLVLAVLLVAVDATVLGLATPFLSEDLEPTGTQLLWIGDVYSFVIAGLLVSMGSLGDRIGRKKLLLVGAVAFGAVSVLNAYATTPEMMIVARALLGVAGATLMPSTLALIRNLFHDPRERSLAIGIWGAMASAGAAVGPVVGGFLLEHFWWGSVFLINLPVMAVLVVVGIKLIPESKNPAPGPWDMLSVGLSLVGMIGVVYAIKETASHGVSWDSAAAAVVGVAALTWFVRRQLRLPAPLLDMRLFHHRGFSGAVLADLLTILGLSGLVFFLSQFLQLVQGRGPLEAGLAELPAAIGAVTAGLLAGFAARRFSVRSVVSGGLAAVGLALGSVTLLDQHTGYPLLGAMLLVVGVGAGFAFTVTADVILSSVPKEQAGSASAVSETAYELGAALGIALLGSIVTGVYRGFPTPAGIPADVEAAHESLGGAVESATALPAAQAGPLVSAAQEAFVDGLRSAAGVGAAVLLAAAIAAWFLLRGQKLEDGIEHP (hide)

Domain analysis:

Biosynthetic assembly:

AMR271

orf_657

Domain Start End Score
Aminotransferase 29 326 108.8

Detection: predicted by Prodigal
Start: 881372 | End: 882584 | Frame: -

Sequence: show MTTGTGTTTGLTARWQRALMDNYGTPRLPLVRGEGAHVWDENGTRYLDFVGGIAVNDLGHAHPAVVEAVSHQIASLAHVSNLFISEPPVALAERLLQLFGRQGRVFFSNSGAEANEAAFKIGRLTGRTHMVATDGGFHGRTMGALALTGQPAKQEPFRPLPGDVTHVPYGDADALRAAVTTDTALVVIEPIQGENGVVVPPKGYLEAAREITRATGTLLVLDEVQTGIGRCGQWFEHQAHQSVEPDIVTLAKALGGGLPIGATVAFGPAADLLKPGHHGTTFGGNPVACAAGLAVIDTLAADGTLDDVKRLGEKIRDGVEALGHPVSHVRGSGLLLGIVLTGPLAPQVQQAAQGAGLLVNAPAPDVVRLMPPLIIGDAEVDAFLEILPDALDAAHGDGRSGA (hide)

Domain analysis:

Biosynthetic assembly:

AmT

orf_658

Domain Start End Score
N-acetyl-glutamate kinase 19 294 298.8

Detection: predicted by Prodigal
Start: 882580 | End: 883525 | Frame: -

Sequence: show MSAARKHTALPKAQTLIEALPWLTRHNGKTVVIKFGGNAMIDEELKAAFAQDVVFLRHAGLKPVVVHGGGPQISAQLDKQGLVSEFKAGLRVTTPEAMDVVRMVLAGQVQRELVGLLNQHGPLAVGMTGEDAHTITATQHRPTIDGESVDIGRVGEITAIDTGAIQALLDDGRIPVVSSIARSADDHHVYNVNADTAAAALAAALNAETLMVLTDVEGLYEDWPNSDDVISRLTASELEKLLPELSSGMVPKMQGCLHAVRNGVETARVIDGRVQHSILLEIFTDEGIGTMVVDAPIDVHTADVHAGPEQGEA (hide)

Domain analysis:

Biosynthetic assembly:

PolP

orf_661

Domain Start End Score
2,3-diaminopropionate biosynthesis protein SbnA 7 308 383.8

Detection: predicted by Prodigal
Start: 885808 | End: 886816 | Frame: -

Sequence: show MPVVSAPYEINADDIFVDLAPVFGVPLHLKCEGFNLAGSIKLKAALEMVRAAEEDGVLTPGSVIVESSSGNLGIALSMIAAHRGYGFVCVTDSRCNRASRRLMESLGAEVRVVTHEDESRGLLGTRLDLVHRMCEEDARYVWLNQYANPNNWRVHYRSTAPAIAAEFPELDVLFVGTGTGGTLMGCARYFRERSRPVTIVAVDSVGSVTFGGPALPRMIPGLGAGVRPPLLDASLVDDVVMVPERDTIDSCHAMARQGFLFGGSTGTVVSGALRWLAAREDAPPLTAVVLAPDQGERYLDTVYDPAWERHFGSPQSWGEPVEQSVRPQELARDS (hide)

Domain analysis:

Biosynthetic assembly:

SbnA

orf_662

Domain Start End Score
Ornithine cyclodeaminase involved in diaminopropionate biosynthesis 4 344 428.4

Detection: predicted by Prodigal
Start: 886832 | End: 887888 | Frame: -

Sequence: show MSHEPRVPSFAVITGEQVAQVLTGGETQVVDLIEEVYRLHGRNSTVNPPSYFLRFPDRPTSRIIALPASLGGEQPTDGLKWISSFPGNVASGVPRASAVLILNDHDTGYPFACLESSIISASRTAASAVLAAGRLSPGERPRRIGFIGTGLIARYIHHYFEATGWTFDEVGVHDLSDDHAEAFAQYLTGRPGDARTVIGATAEEVIRGSDLVVFATVAATPHVHDPAWFTHNPLVLNVSLRDVAPEVVLASANFVDDVEHCLKADTSVHLTEQRTGNRDFIDGTLHDVLEGRAEVPTDRPVIFSPFGLGVLDIALGRHVHDRLREAGRLGVVDGFFHELDRYGTGTLPAL (hide)

Domain analysis:

Biosynthetic assembly:

DdaB

orf_663

Domain Start End Score
Adenylation+ 222 623 325.3
2,3-diaminopropionate 2 401 419.0
Serine 23 401 392.0
2,4-diamino-butyric acid 23 401 376.5
Tryptophan 23 401 360.3
Phenylalanine 23 401 358.5
Glutamate 23 401 340.7
Alanine 23 401 330.4
Arginine 23 401 326.4
Lysine 23 401 313.6
Beta-lysine 23 401 109.1
Thiolation 734 795 43.1

Detection: predicted by Prodigal
Start: 887980 | End: 891535 | Frame: -

Sequence: show MTITGAPQRLIPRWIPSAGARPGHAELTRAVPVRLSARVRLLARRSAAPWEAAALAAHAAVLGALSGEQAFVTGYVPPAPAAGAASGDIRPCALTVDDGSWRTLLTTAARAVGNAVDGAFETVLDLGPGQPYRSPDAALTVALRSGPEGPALHLRYRTDVLDAEAAERVAGYYVTAWEHMAAAPDAPWRGSSLLSDDELRRQLHGMAGPARALPDRRFHELFEEQVALRPDATAAVHGSDSHTYGELNAKANRIAHALLARDLGPEAVVAVVTERHLDWQAAVIGVFKAGAAYLPIEPGLPAERMGRMLERSGCRLALTEEGGSGQVVRAAPADLDVLTVAAALDEGHPEHNPGIQVAPGQLAYLYFTSGSTGEPKGAMCEHDGFVNHLCAKLEDLGVDEGQVVAQTAPQSFDISLWQLVSALVVGGRTLIVEQDAILDVDRFLETVERGGVTVLQIVPSYLEVLLSRLEDSPGRLPRLRCVSVTGEALKKELTVRWFARFPDIALVNAYGLTETSDDTNHAVLTAVPERDSVPLGPPVRNVTVYVVDDDLRPVPLGAPGEIVFSGVCVGRGYVNDPVRTEQAFGEDPHRPGHRLYRSGDFGRWLPDGSLEFLGRRDAQVKIRGFRIEIGEIENQLLRLSGVRDGAVVVVDDPDGGRELVGFQAGSELPSGTLLDALAQSLPEYMVPRRIVRLDALPLTPNGKTDKRALRALAQELLTATEQEAQDPPRTDEERRMAEAWAEVLRVPVDRIGRESDFFALGGTSLSAIRLVVRAERAFTLRDVRAHPTLAGLAARDTAEGRADEGASCSPAADNRAADNRAADNRPDDATAPAAARNNLRDAGSEHTVAPASDPAANASFDVVRTEGRPAVLDLGRAAPADPVAWATGHRARLHATVAEHGAVLVRGLGLRDAETVGRVARELLHEVMTEREGFAARRVLADGVHSSSEWPAEQPMCMHHELSYAREVPGTLIFACLTAPSSGGVTAVADSQEVLEALPAGLVERFESEGWLLDRNYTDLTGIGLAAAFGTGDRAAVDAYCAARGIETRWADDGGLRTRQRSAALLRHPVSGRRSWFNQVSFLSEWTLDAAVREYLKFEFGDDGLPFNTRYGSGAAIDEATVLAINEVYEKHTLRERWRAGDLMIVDNLRMAHSREPYEGSREVAVVLGDPVAIPAFPGPAGP (hide)

Domain analysis:

Biosynthetic assembly:

DapT

orf_664

Domain Start End Score
Thioesterase 8 145 51.5

Detection: predicted by Prodigal
Start: 892200 | End: 892998 | Frame: +

Sequence: show MRSDDDALADRWLRCITKWGGSPRARLICFPHAGGTASYFRDWARLVPPDIDVRAVRYPGREDRLTDSFAETMEELADAVTSAVEPLLDRPTAFFGHSMGASVAYEVAARLHAKRDRSNAPAPVALFLSGRAGPGHEYVRNLGEDDEALMADVIGMGGMNAHTFSDPELRDLVLPAIRADFRLVERYGRTSPGNPLLDTPVFAYYGDRDDHLDPSAVDAWSAVTRGPFAARSFTGGHFYLAQHARQLVGDVIGSLRPLLGEPVR (hide)

Domain analysis:

Biosynthetic assembly:

TE

orf_666

Domain Start End Score
Condensation+ 8 303 144.4
bacil2_C1_start 260.0
act2_C1_start 232.0
EndA_-_enduracidin_C-starter 229.0
antE_Antimycin_C-starter 198.0
Skyllamycin_C-starter 195.0
GlbF_-_Glidobactin_C-starter 192.0
HrmO_hormaomycin 188.0
LpmA_-_Laspartomycin_C-starter 188.0
WS9326_C-starter 180.0
griA_griselimycin 178.0
Adenylation+ 465 866 358.0
Asparagine 23 401 655.8
Aspartate 23 401 595.1
Threonine 23 401 520.2
Phenylalanine 23 401 507.6
Tryptophan 23 401 493.0
Alanine 23 401 485.1
Glutamate 23 401 479.2
Lysine 23 401 478.8
Glycine 23 401 478.2
Asparagine 23 118 113.0
Thiolation 979 1041 48.3
Epimerization+ 1091 1387 138.8
syrin1_C4_dual 281.0
syrin1_C3_dual 279.0
syrin1_C2_dual 265.0
syrin1_C8_dual 245.0
compl4_C1_DCL 124.0
tyroc3_C1_DCL 117.0
micro2_C1_DCL 117.0
cdaps3_C1_DCL 107.0
compl3_C5_DCL 107.0
fengy2_C1_DCL 107.0
Adenylation+ 1550 1961 374.9
Threonine 23 411 812.3
Threonine 23 411 706.2
Allo-threonine 23 411 670.0
Serine 23 411 608.6
Alanine 23 411 545.7
Glycine 23 411 539.1
Phenylalanine 23 411 528.0
Aspartate 23 411 524.0
2,3-dehydroaminobutyric acid 23 411 509.4
Pipecolic acid 5 411 120.0
Thiolation 2070 2132 53.0
Epimerization+ 2182 2477 136.6
syrin1_C4_dual 270.0
syrin1_C3_dual 265.0
syrin1_C2_dual 263.0
syrin1_C8_dual 233.0
compl4_C1_DCL 120.0
micro2_C1_DCL 119.0
cdaps3_C1_DCL 112.0
tyroc3_C1_DCL 111.0
compl3_C1_DCL 107.0
compl3_C5_DCL 107.0
Adenylation+ 2639 3042 383.9
Serine 23 403 807.5
Alanine 23 403 641.6
Glutamate 23 403 600.0
Glycine 23 403 588.0
Arginine 23 403 563.8
Hydroxyphenylglycine 23 403 555.0
Phenylalanine 23 403 552.6
Glutamine 23 403 546.2
Lysine 23 403 540.2
Alanine 23 169 117.0
Thiolation 3152 3216 45.0
Condensation+ 3231 3534 226.8
act3_C3_LCL 355.0
act2_C2_LCL 348.0
act3_C2_LCL 346.0
cyclom1C2_LCL 345.0
cyclom1C4_LCL 343.0
cyclom1C1_LCL 339.0
prist2_C3_LCL 337.0
cyclom1C3_LCL 335.0
bacil2_C2_LCL 330.0
cdaps2_C2_LCL 328.0
Thiolation 3818 3882 44.6
Epimerization+ 3933 4228 138.3
syrin1_C4_dual 276.0
syrin1_C3_dual 273.0
syrin1_C2_dual 258.0
syrin1_C8_dual 229.0
compl4_C1_DCL 119.0
micro2_C1_DCL 115.0
cdaps3_C1_DCL 107.0
tyroc3_C1_DCL 107.0
compl3_C1_DCL 105.0
compl1_C1 104.0
Adenylation+ 4397 4809 375.7
Threonine 23 412 810.1
Threonine 23 412 705.1
Allo-threonine 23 412 665.8
Serine 23 412 595.0
Alanine 23 412 534.7
Phenylalanine 23 412 528.6
Glycine 23 412 522.4
Aspartate 23 412 511.3
2,3-dehydroaminobutyric acid 23 412 506.6
Histidine 23 107 110.4
Thiolation 4918 4981 46.6
Epimerization+ 5032 5329 156.3
syrin1_C2_dual 274.0
syrin1_C4_dual 270.0
syrin1_C3_dual 266.0
syrin1_C8_dual 255.0
micro2_C1_DCL 120.0
cdaps3_C1_DCL 118.0
cdaps2_C1_DCL 117.0
compl4_C1_DCL 112.0
compl3_C1_DCL 105.0
grami2_C1_DCL 105.0
Adenylation+ 5495 5910 377.8
Threonine 23 415 762.9
Threonine 23 415 636.9
Allo-threonine 23 415 616.2
Serine 23 415 583.4
Phenylalanine 23 415 543.6
Glycine 23 415 538.1
Alanine 23 415 527.9
Lysine 23 415 493.5
Aspartate 23 415 491.9
Alanine 23 219 111.3
Thiolation 6030 6094 58.0

Detection: predicted by Prodigal
Start: 893692 | End: 912049 | Frame: +

Sequence: show MSEQDGVFHELMAAQLGIWTAQHLHPDNPIYNVGEYMEINGELDVDLFERALRSAVREAEAVHTRFVGEGEAVRQHVRVSDDWPFHRIDLSGEPDPRARAEEWMRTDMRRPVDMRGDALFTQAMLRLGPDHVYWYQRCHHILGDGFSGPLVNNRIAQIYAALRAGDAYDEGALAPFSNLLDADRAYRGSEEQAKDRAYWGEIFADLPTPVSLSGRIPAGTPHHLIRGTAEMPSEAAADLRTTARSLRTSISGMAIAAAAVYLNRATGAEDVVVALPVFGRFGSAQRQTPGMATNLLPIRLTVRSSMTVQELVRQVSVQVRGALRHQKYRYEDMLRDLRLIGRGNLASMVVNVVPYAYDFSFGDCEVRAHALSSGHFNDVAFCVYDRSADGRIQIATDASPELYSPHANQRHTDRLHTVLTWLATAAPEDRVGRVEILDEAERRQVLQDWNDTDRPVPATTLTQLLEEQATHTPGKPAVSSQGVDRSYAELHASANRLARLLVSRGVGPESLVAVSMERSVDLVVALLAVLKAGGAYVPVDPEYPADRIAHMLEDARPVLVLTSEAVAPSLPDVAGLERVVIDEPGVGAALNGLGTAALTASERRGPQLPSHPAYVIYTSGSTGRPKGVLITHQNLVNYVSRCTEAYPDLHGTTLLHASISFDAGVTALYGALTCGGRVIVEPMDEHLPATLRTHELAFLKATPSHLTYLDGFDESCAPTGQLMVGGEAVGGTQIRDWRRRHPSVAVVNHYGPTEVTVGCTDYVVTADDDTETATLPIGRPMWNTRVYVLDAALRPVPAGVPGELYVAGDQLARGYLGRPGLSAERFIACPFGTAGERMYRTGDVVRWRTDGNLEFLGRADDQVKIRGYRIELGEIESALESHGDVSRAAVLVREDVPGDKRLVAYVVPTVSGDTLDAVDTAALRGHLGRVLPEYMVPSATVVLEALPLTVNGKLDRRALPAPEYTAAGGGRAPASLQEEILCAVFAEVLGVPAVGVDDNFFELGGHSLLAVSLIELLRERGMSVSVRDLFAAPTAAGLAAASAGAGSVTVPENLIPAGAETITPEMLPLVDLTAEEIERISARVQGGAANIADIYPLAPLQEGIFFHSVLGGDSGADVYVLPTVLGFDTRDRAERFLEALQSVVDRHDILRTGFAWEGLREPVQVVLREATLPVEELQLAPRPDTDPVQQFLELCSPSLDIRQAPLLRATVAAEPGGDRWLVALQAHHLVRDHTTLEILLGEVRTLLGGDAGALPVPVPFREFVAQARLGVSRAEHERFFGELLSGVSEPTAPFGLLDVHGDGSDVTEATAVLDADLAARLREQARRLSVSPATLFHLVWARVAAVTSGRDDVVFGSVLFGRMQAGTGADRTPGLFINTLPVRVPTGQVPVGEAVRAMQKQLADLLVHEHAPLMVAQQAADLAAETPLFTSLLNYRHSTGASGDEPSIGLDGVELLSVRERTNYPVTVSVDDTGDGFGLTVQTAAPLDAESVCGLLGAAAEGVVAALENESEGLLLGRVPVLGGAEQDRLVREWSGESRPVAEASLTELFAAQAVRTPEATAVTFEGVGWSYAELDARANRLARLLITRGVGPESLVAVCMERSADLVVALLAVLKAGGAYVPIDPEYPADRIAYVLEDAQPALVLTSESVRSVVPGVEGLERVVVDAAQTVSALADLSGEPVSSVEVLPSHVAYVIYTSGSTGRPKGVAIPHGNVVALFGGTDGWFGFGTGDVWAWFHSFAFDFSVWELWGALLHGGRLVVVPREVSRNPREVLELLVAQHVTVLNQTPSAFYQLMAAENRDPELGERLALRCVVFGGEALDLSRLRAWYTRHAADTPVLVNMYGITETTVHVSYMPLDEAVVAADTGSVIGMGIPNLRVFVLGSDLRPVPVGVPGELYVAGAQLARGYVGRPGLTAERFVANPFGTPGERMYRTGDVVRWRTDGNLEFLGRADDQVKVRGFRIELGEIEATLMSHAAVAQAAVLVREDVPGDKRLTAYVVPAVPGDTADTTALRAHVGARLPEYMVPSATVVLDALPLTVNGKLDRRALPAPEHTATAGRAPANAQEEILCSVFAEVLGVPGVGIDDNFFELGGHSLLAVSLIERLRERGVSVSVRDLFAAPTVAGLAAASADGERVSVPENLIPAGAETITPEMLPLVELTAAEIERISARVQGGAANIADIYPLAPLQEGIFFHSVLGGDSGADVYVLPTVLGFDTRDRAERFLEALQSVVDRHDILRTGFAWEDLREPVQVVLRHAEIPVNEVDLGGFEGDLAQGLLALCSPSLDIRQAPLLRATVAAEPGGDRWLLALQVHHLVQDHTALAVLLGEVRTLLGGDAGALPVPVPFREFVAQARLGVSRAEHERFFGELLSGVSEPTAPFGLLDVHGDGSDVTEATAVLDADLAARLREQARRLSVSPATLFHLVWARVAAVTSGRDDVVFGSVLFGRMQAGTGADRTPGLFINTLPVRVPTGRVPVGEAVRGMQKQLADLLVHEHAPLMVAQQAADLAAETPLFTSLLNYRHNERPREQMSLDLAGADIVYTRERTNYPLTVSVDDTGEGFGLTVQASAPIAAESVCGLVGAAAEGLVTALEDEAASLALHRIPVLGEVERDRLVWGWNDTDRSVPQVSLTELLAAQAVRTPEATAVVFEGVGWSYAELDARANRLARLLIARGVGPESLVAVCMERSADLVVALLAVLKAGGAYVPIDPEYPADRIAYVLEDAQPALVVTSRATEGAVPEGADIPARVQVDGADVLAQLKALSGEPVSSVEVLPSHVAYVIYTSGSTGRPKGVAVPHQGVVNRLLWMQDTFPLDGSDRVVQKTPFGFDVSVWEFFWPLITGAGLVVARPGGHRDAGYLTELIRHEKVTVAHFVPSMLRVFLREPDAAACTGLRWVVCSGEALPPELRDQFFDVLEDVELHNLYGPTEASVDVTAWPCTPDEGPAVPIGHPVWNTRTYVLDTGLHPVPVGVAGDLYLAGDQLARGYLGRPGLTAERFVANPFGTTGERMYRTGDVVRWRTDGNLEFLGRADDQVKVRGFRIELGEIEAALMSHAAVAQAAVLVREDVPGDKRLVAYVVPAVPGGTVDTTTLRAYVGSRLPEYMVPSATVVLDTLPVTVNGKLDRRALPAPEYAAASGGRAPANAQEEILCSVFADVLGVPHVAVDDNFFELGGHSLLAVRLVSRVRTVLGVETGVRTVFEAPTVELLAKRLENADEARPALSARTRPEPVPLSFAQQRLWFLGELEGPNATYNIPAAIHLHGTLDTQALSAALNDVVARHEVLRTVFPMVDGQPQQRILDPDQARCELTTMELSPQNAEEAMAEAAAGVFDLATDLPLRAWLFTTGTNEHILMLVLHHVAGDGWSMAPLAHDVSLAYTAHTTSSTPTWEPLPVQYADYTLWQRELLGDETDPHSLMAQQLAYWRQALADIPDELALPLDRPRPAIATHQGGIVDLTIEPDIHTRLLHTARTHGVTLFMVLQAATAALLNRLGAGRDIPLGVPVAGRSDEALENLVGFFVNTLVIRTDLTADPSFTQLLEQVRETGLAAHTHADIPFERLVEELAPTRSMARHPLFQIMLSLDTHADAVVDLPGLDAEVIASKDSAAKFDLDLNVRERFDASGAPAGLRGTVVYAVDLFDEATVAELVERFVRVLEAVTADPHQPVSRIRILGDAELDRILTEWKGCATGIPARTVPVLEAAPPSGADAGGKVFVLDAALQPVPVGVTGDLYVAGGLTDRGYEGRPGLTAERFVACPFEGAGERMYRTGDVVRRRADGSLELVGSAHEEREPNASTAVGEGQSARRRGPSSVQEEILSSVFAEMLDLPQVGVDDNFFELGGHSLMAVKLVVRLRELGMPVSVRSLFATPTVAGLAAAVSAGGQSTVTVPENLIPAGADVITPEMLPLVELTAAEIERISARVQGGAANIADIYPLAPLQEGIFFHSVIGNENGADVYVLPTVLRFDSRERLDRFLSVLQTAVDRHDTLRTGFAWEGLREPVQVVVRHAEIPVNEVDLGGFEGDLAQGLLALCSPSLDIRQAPLLRATVAAEPGSDRWLMVMQAHHLVQDHTAMGVLFAEVSALLRGDAAELAAPVPFREFVAQARLGVSRAEHERFFGELLSGVSEPTAPFGLLDVHGDGSDVTEATAVLDADLAARLREQARRLSVSPATLFHLVWARVAAVTSGRDDVVFGSVLFGRMQAGTGADRTPGLFINTLPVRVPTGRVPVGEAVRGMQKQLADLLVHEHAPLTLAQQAADLAAETPLFTSLLNYRQNANAAQRLGRSIAELNTGLDGVELLSAHERTNYPVTVSVDDTGEGFGLTVQAAAPITAQAVCRLVSSTAEGVVAALENESEGLLLGRVPVLGGAEQDRLVREWSGESRPVAEASLTELFAAQAVRTPEATAVTFEGVGWSYAELDARANRLARLLIARGVGPESLVAVCMERSADLVVTLLAVLKAGGAYVPIDPEYPADRIAYVLEDAQPALVLTSRATADAVTDGANAPARVLVDGTDVLAQLETLSGEPVSSVEVLPSHVAYVIYTSGSTGRPKGVAVPHGNVVALFGGTDGWFGFGTGDVWAWFHSFAFDFSVWELWGALLHGGRLVVVPREVSRNPREVLELLVAEHVTVLNQTPSAFYQLMAAENRDPELGERLALRCVVFGGEALDLSRLRAWYTRHAADTPVLVNMYGITETTVHVSYMPLDEAVVAADTGSVIGMGIPNLRVFVLGSDLRPVPVGVPGELYVAGAQLARGYVGRPGLTAERFVANPFGTPGERMYRTGDVVRWRTDGNLEFLGRADDQVKVRGFRIELGEIEATLMSHAAVAQAAVLVREDVPGDKRLTAYVVPAVPGDTADTTALRAHVGARLPEYMVPSATVVLDALPLTVNGKLDRRALPAPEHTATAGRAPANAQEEILCSVFAEVLGVPGVGIDDNFFELGGHSLLAVSLIERLRERGLSVSVRSLFATPTVAGLAVALGAGGQGAVSVPENLIPAGAETITPEMLPLVELTAAEIERISARVQGGAANIADIYPLAPLQEGLFFHHLMTGEGEADVYLQQTVLRFDARQRVDRFVEALQAVMVRHDILRTGFAWEGLREPVQVVVRRAEVPVHEVALDAVSGGQDAVQQLLDAADRTMDVGRAPLLRAYIGAEPGSDRWLMLLQNHHLVEDHTALELLLAEVRAHLEGQEDALPAPVPFREFVAQARLGVSRAEHERFFGELLSGVTEPTAPYGLLDVRGDGTEVDEVMSTLDAAVSARLREQARRLGVSPATLFHLVWARVAAVTSGRDDVVFGSVLFGRMQAGTGADRTPGLFINTLPVRVPTGRVPVGEAVRGMQKQLADLLVHEHAPLTLAQQAAGLPAQTPLFTSLLNFRHNTAGSTGPDDAMSGALEGVELLSAHERSNYPLTVSVDDAGSRFDVVVQAAAPLSPQAVTGLIHAAAANLVTALEEETGATGLHEVQVLDETDQRQLLTRWNDTAHEVPVTTLPRLFADQAGRTPDAVAVTFEGAELSYAELDARTNRLARLLIARGVGPESVVAVSMERSAELVVALLAVLKTGGAYVPVDPEYPADRIAYMFGDARPVLVLTSRSAAGGLPVVAGLDRVVVDEPQTVTALAGLDAGEIAETELRCALLADHPAYVIYTSGSTGNPKGVAVPHRNVVQLFEAAKGRYDFGADDVWTWFHSFSFDFSVWEMWGALLHGGRLVVVPHAISRSPGGFLDLLVRERVTVLNQTPSAFYQLVQAEAEAPDAGSRLALRFVIFGGEALDHRRLTEWFVRHPENAPALVNMYAPTETTVVCTAYPVSAREEDSTGVLPIGSPMWNTRAYVLDDSLCPVPVGVAGELYLAGAQLSRGYTHRPGLTAERFVACPFGAAGERMYRTGDVVRRRADGHLDYVGRADDQVKVRGFRIELGEIEAVLASHPLVGQAAVVVREDSPGDKRLVGYVVADPAAENSGAASDLSASALSAAVRGYVRERLPDHMVPSAVLRLDVLPLTVNGKLDRRALPAPDYRVAGSNRAPSTPREKELCDLFAEVLGVPEVGVDDSFFDLGGHSLLATRLVSRVRTALGVELPIRTLFEAPTVAGLASREARTNTKRARPALRPRPRPTQEEN (hide)

Domain analysis:

Biosynthetic assembly:

C*AsnTEThrTESerTCTEThrTEThrT

orf_667

Domain Start End Score
Condensation+ 1 302 229.9
act2_C2_LCL 367.0
act3_C2_LCL 367.0
act3_C3_LCL 363.0
cyclom1C4_LCL 345.0
cyclom1C2_LCL 344.0
bacil2_C2_LCL 332.0
cyclom1C5_LCL 321.0
cdaps3_C2_LCL 321.0
cyclom1C3_LCL 319.0
cdaps2_C2_LCL 319.0
Adenylation+ 472 874 386.6
Serine 23 402 830.8
Alanine 23 402 653.2
Glutamate 23 402 616.2
Glycine 23 402 608.7
Arginine 23 402 587.7
Phenylalanine 23 402 563.5
Aspartate 23 402 555.4
Glutamine 23 402 554.1
Hydroxyphenylglycine 23 402 553.9
3-aminonon-5-enoic acid 2 402 120.2
Thiolation 984 1046 50.6
Epimerization+ 1096 1393 154.1
syrin1_C3_dual 259.0
syrin1_C4_dual 259.0
syrin1_C2_dual 250.0
syrin1_C8_dual 236.0
micro2_C1_DCL 123.0
cdaps2_C1_DCL 112.0
liche2_C1_DCL 112.0
compl4_C1_DCL 111.0
grami2_C1_DCL 111.0
compl3_C1_DCL 108.0
Adenylation+ 1558 1951 351.2
Glycine 23 393 544.4
Tryptophan 23 393 530.4
Serine 23 393 528.0
Phenylalanine 23 393 526.6
Lysine 23 393 513.3
Aspartate 23 393 502.3
Alanine 23 393 498.3
Arginine 23 393 497.7
Threonine 23 393 484.7
3-methyl-2-oxopentanoate 4 393 118.5
Thiolation 2061 2125 45.7
Condensation+ 2140 2443 227.9
act3_C3_LCL 357.0
act2_C2_LCL 349.0
act3_C2_LCL 348.0
cyclom1C2_LCL 347.0
cyclom1C4_LCL 345.0
cyclom1C1_LCL 339.0
prist2_C3_LCL 338.0
cyclom1C3_LCL 337.0
bacil2_C2_LCL 332.0
cdaps2_C2_LCL 330.0
Adenylation+ 2613 3025 374.6
Glycine 32 412 650.0
Glycine 32 412 551.3
Serine 32 412 536.7
Threonine 32 412 510.5
Phenylalanine 32 412 506.7
Alanine 32 412 506.1
Aspartate 32 412 501.6
Lysine 32 412 487.5
Tryptophan 32 412 471.2
β-phenylalanine 24 412 109.0
N-methyltransferase 3118 3340 311.3
Thioesterase 3629 3814 121.0

Detection: predicted by Prodigal
Start: 912048 | End: 923700 | Frame: +

Sequence: show MIPLSFAQRRLWFLAQLEGPNPTYSIPAALRLRGELDVAALHAALRDVVERHEVLRTVFPAADGTPHQRILDADAVPLDLPVIPTAGEEALAAALAEATAQPFDLAADIPIRARLHELEPQEHVLLLVLHHIASDGWSMGLLARDISEAYGARRAGHAPRWEPLPVQYADYTMWQLDLLGDEGDPESVLAEQLSHWRATLAGVPEELRLPAARTRPATASYRGGQEPLRIDAELHRRLTELARAEGATLYMVLQAGLAVLLSRLGAGDDIPVGTPIAGRMDDALDDLVGFFVNSLVMRTDLSGDPSFTDLVSRVRDAALSAFAHQDVPFERLVEELVPTRSMGRHPLFQVMLAVQNNAQAVLDLPGLQVSALPGGNAPAKFDLSFDLSEEFDAQGRPAGLKGSITWALDLFDRETVEDLSTRFVRVLDACTTDPSVRVSQVPVLGEVERDRLVWGWNDTDRSVPQVSLTELLAAQAVRTPEATAVVFEGVGWSYAELDARANRLARLLIARGVGPESLVAVCMERSADLVVALLAVLKAGGAYVPIDPEYPADRIAYVLEDAQPALVLTSESVRSVVPGVEGLERVVVDAAQTVSALADLSGEPVSSVEVLPSHVAYVIYTSGSTGRPKGVAVPHQGVVNRLLWMQDTFPLDGSDRVVQKTPFGFDVSVWEFFWPLITGAGLVVARPGGHRDAGYLTELIRHEKVTVAHFVPSMLRVFLREPDAAACTGLRWVVCSGEALPPELRDQFFDVLEGVELHNLYGPTEASVDVTAWPCTPDEGPAVPIGRPVWNTRTYVLDTGLRPVPVGVAGDLYLAGDQLARGYLGRPGLTAERFVANPFGTAGERMYRTGDVVRWRTDGNLEFLGRADDQVKVRGFRIELGEIEAALTSHATVAQTAVLVREDVPGDKRLVAYVIPTRSTGTVDTAALRTHAGRVLPEYMVPSAVMVLDTLPVTVNGKLDRRALPAPEYAAASGGRAPANAREEILCSVFADVLGVPAVGVDDNFFELGGHSLLAVRLVERLRAQGVPVDVRALFAAPTVAGLAAASLDREAVAVPENVIPADAEALAPEMLPLVDLTAEEIERIVSRVPGGAANIADIYPLAPLQEGLFFHHLMTGEGEADVYLQQTVLRFDARGRLDQFLDALQKVVDRHDILRTGFAWEGLREPVQVVAREAAVAADEIHLDVRADENPVERLLAACAASMDVGRAPLLRAYVAAEPGHDRWLMVLQNHHLVLDHTTFDVLLDEVRALLRGDAAELAAPVPFREFVAQARLGVSRAEHERFFGELLSGVSEPTAPYGLVDLRKEGSGGITEVSTPVDAGLAARLREQARRLGVSPATLFHLVWARVVAVTSGRDDVVFGSVLFGRMQAGTGADRTPGLFINTLPVRVPTGRVPVGEAVRGMQKQLADLLVHEHAPLTLAQQAADLAAETPLFTSLLNYRHDMAGSTGPDDAMSGALEGVELLSAHERTNYPLAVSIDDAGTDFGVTVQAADPIAPHDVCALVHTVTAELVRVLENESATELCRIEALGGSERHRMLSVWNDTARETRPTTLTELWHAQVARTPEAVALVHESVRLTYAELDARADRWADVLVDRGVGPEQLVAIALPRSADTVVALLAVLKAGGAYLPLDPSHPAERTAYVLKDARPTALITTAASAEAFADPAVPRLLIEDMERAEPSAGRPPRAGEALPSHPAYVIYTSGSTGRPKGVVVSHGSAAAFSIGGASAYGIDEQDRVLGFAAFTFDVSVFEVFTTLTAGATLILAGDEDRLNADRLHSLMAGQGVTVAELPPALMPLLCPDGLPALRLVSTGGELPAGRLVDQWASPDREFWNGYGPTETTVAITLMRCLPPSHGQAPPIGRPMPNARVFVLDAGLCPVPVGVAGELYLAGDQLARGYLGRPGLTAERFVANPFGTTGERMYRTGDVVRWRTDGNLEFLGRADDQVKIRGFRIELGEIEATLTSHAAVAQAAVLVREDTPGDKRLVAYVVPAVPGDTADTTALRDHLGRVLPEYMVPSAIMVLDTLPVTVNGKLDRRALPAPEYAAASGGRAPANAQEEILCSVFADVLGVPHVAVDDNFFELGGHSLLAVRLVSRVRTVLGVETGVRTVFEAPTVELLAKRLENADEARPALSARTRPEPVPLSFAQQRLWFLGELEGPNATYNIPAAIHLHGTLDTQALSAALNDVVARHEVLRTVFPMVDGQPQQRILDPDQARCELTTMELSPQNAEEAMAEAAAGVFDLATDLPLRAWLFTTGTNEHILMLVLHHVAGDGWSMAPLAHDVSLAYTAHTTSSTPTWEPLPVQYADYTLWQRELLGDETDPHSLMAQQLAYWRQALADIPDELALPLDRPRPAIATHQGGIVDLTIEPDIHTRLLHTARTHGVTLFMVLQAAMAALLNRLGAGRDIPLGVPVAGRSDEALENLVGFFVNTLVIRTDLTADPSFTQLLEQVRETGLAAHTHADIPFERLVEELAPTRSMARHPLFQIMLSLQNNAQADLDFPGLRAEAVAAGHVSAKFDLEIGLSERSGPGGEPGGLHGSIIYATDLFDPTTAEWMAKLYARFLDAVTAAPSTPLSRVDILEDAERRTILEEWNDTGHRTTARNLPELLQRRAERTPDAVAVLFQDVEDGLGHDRAELTYAQLHARANRLARLLMTHGVGPETLVAVCMERSPDLVVTLLAVLKAGGAYVPVDPEYPADRIAHVLDDARPAVVLTSRATDAALGTGTGTVRIVVDDPRAVSALTGLDAGPVDDAERTSPLLPSHPAYVIYTSGSTGRPKGVTVPHRAVTNFLAAMDDRCPLDERDRLLAVTTVAFDIHVLELYLPLLAGASVAVAPRAAARDPRLLVALAERLDVTVMQATPTLWQAVLDEDPTALKGARILVGGEALPSSLSERMLAAPGRATNLYGPTEATVWATTAELTAGEQGSVASIGRPLWNTRAYVLDDRMQPVHAGVAGELYLTGDQLARGYQGRPDLTAERFLACPFGAPGERMYRTGDLVRWSPDGSLEYLTRVDDQVKIRGFRIELGEIEAGLTAHAEVTQAAVVARDDAHGSRQLVAYVVPGSRVAERDQEGEDRQVENWQSVYDSLYRDMAPDDGTELGENFDVWVSAYDGSRIPESHLQEWRSVIVDRILDLEPRRILELGVGNGPLLARLAPRCEEYWGTDLSAEGIEVLRRGVEQQPELRDRVHLRAQGADVTDGLPRDYFDTIVLNSVVQYFPNAEYLLEVLRNAVDLLAPGGRIFVGDVRNLRLHRCLSTAVALRRHERGSEADAVRRAVEQMLLNEQELLVDPDFFPVFCAASAELEHADILVKRGVHHHEMSRHRYDVVLHKKSSGQPSSQAVAGAEETTLRWGTDVAGLAELAGLLRTGRPARLRVTFVPHRGLAGEIAALRLLDAGEPVGTALAALGSDGSATGALDAEDLHLLGESLGYRTTVTLTGAADDGSMDAVFESAVLESAVLDAPESDALRAAGPADAYRPAGPGRSDLASCTNNPVARSRSVADLTGTLRDHLSDRLPEYMVPAAFVVLDALPQTANGKLDRRALPAPDHTRGEAGRAPASGREEVLCGLFAEVLRLPQVGVDGNFFELGGHSLLGVRLADRIRSVLGVEIGIRDLFEAPTPEALAARFADAGMTREALGGLLPIRARGNRPPYFCVHPAGGTGWCYVPLTRHMPEDQPLYALQGRGVGPVPEELPSSVRDMAADYVAQIRAVQETGPYHLLGWSFGGIVAHEMAVLLRAEGHEVASLVIMDAYPMPEEERADDSAGPVDLTEVVVQGAGRFGAELTPEEIDRFARVIDNNARIQRAHVGVFDGDVLVVVAAADREESGADAGLWAPHVSGVTAETEVPCRHDDMAHPDMLRRIWDAVTEHAHPAPGQ (hide)

Domain analysis:

Biosynthetic assembly:

CSerTEGlyTCGlyNMTTE