Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 4

Unknown thiotemplated cluster type
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_438 KRT
orf_439 MeMDHKS
orf_441 KS
orf_442 KRT

Cluster:

    

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Error: Unable to generate predicted structure!

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_438

Domain Start End Score
Ketoreductase+ 2 119 149.8
Active ketoreductase, cluster 2 1 117 186.3
Inactive ketoreductase, cluster 1 1 117 182.8
Active ketoreductase, cluster 1 1 117 153.6
Active ketoreductase, cluster 4 1 117 137.0
Inactive ketoreductase, cluster 2 1 117 132.8
Active ketoreductase, cluster 12 1 117 108.6
Active ketoreductase, cluster 6 1 117 102.3
Active ketoreductase, cluster 3 1 117 94.0
Inactive ketoreductase, cluster 4 2 117 86.5
Active ketoreductase, cluster 5 1 62 7.8
Thiolation 224 291 46.8

Detection: predicted by Prodigal
Start: 607972 | End: 609115 | Frame: -

Sequence: show MADREAMAALLASVPADAPLTGVVHTAGVIDDGVITALTPERLDTVFRPKVDAALVLDELTRDLDLSAFVLYSSAAGTFGSPGQGNYAAANAFLDALAQRRRAAGLPATSVAWGGWAESSGMTAHLAASDLQRMSRGGGVELTSEEGLEVFDRAWRDPAPVLVAAKLDFVTLQAQAAAGSVHSLLRGLITTRRQTTQPQRPAGPRLAEQLAATSPARQEEFLLDVVRREVAATLGHASGGQVDADQGFSDIGFDSLLAVELRNKLTELTTLRLPATLVFDYPTPRSLARFKKELRPESNGTHDVAGREDEFRRMLATTPMARFEELGLMHTLMALLDEQGSEAAGTAAVAEQQQDSTSLIREMGVDDLIARAMKETRNQ (hide)

Domain analysis:

Biosynthetic assembly:

KRT

orf_439

Domain Start End Score
Acyltransferase+ 1 116 102.0
Methylmalonyl-CoA 1 91 198.8
Methylmalonyl-CoA 1 91 198.2
Methylmalonyl-CoA 1 91 189.8
Methoxymalonyl-CoA 1 91 169.1
Methylmalonyl-CoA 1 91 163.6
Ethylmalonyl-CoA 1 91 144.2
Ethylmalonyl-CoA 1 91 138.6
Ethylmalonyl-CoA 1 91 125.9
2-Methylbuteryl-CoA 1 91 109.6
Isobuteryl-CoA 1 91 80.2
Dehydratase+ 184 349 247.1
Active dehydratase, cluster 2 2 165 202.7
Active dehydratase, cluster 3 2 165 201.5
Active dehydratase, cluster 6 2 165 200.9
Inactive dehydratase, cluster 2 2 165 198.5
Active dehydratase, cluster 8 2 165 194.4
Active dehydratase, cluster 4 2 165 188.8
Inactive dehydratase, cluster 6 2 165 179.9
Active dehydratase, cluster 19 2 165 178.4
Inactive dehydratase, cluster 13 2 158 149.1
Inactive dehydratase, cluster 1 139 165 5.0
Ketosynthase+ 1128 1553 587.0
5_hygrocin_cis_Mal 641.0
8_vicenistatin_cis_MeM 637.0
3_chlorothricin_cis_Mal 637.0
4_hygrocin_cis_EtM 636.0
9_meridamycin_cis_Mal 635.0
3_vicenistatin_cis_MeM 635.0
4_divergolide_cis_EtM 634.0
9_cremimycin_cis_Mal 631.0
8_tirandamycin_cis_Mal 630.0
14_meridamycin_cis_MeM 630.0

Detection: predicted by Prodigal
Start: 609054 | End: 622719 | Frame: -

Sequence: show MRRIPVDYASHSVQVEEIEEELGSVLEGIVPRAGRVPFYSTVTGAPVDTTMLDGGYWYRNLRHTVRFEEATRALAAAGHRVFVEVSSHPVLVPGVEETVEACAVGSSVVTGTLRRNENGPGRFVEALARLHVRGVGVDWAALLGRDSGWPIDLPTYAFQRQRFWLESGRGAGDPSVLGLAGVDHPLLGARADIPATSGVLFTSRWSLWSQPWLADHSAAGVTLVPGTAFVDLVVRAGDEVGCGLLSELVIEAPLVIPEQGGVQVRVSLSETDDSGQRTVQVHSRAEDAGPGVDWTRHVSGRLAPEAAHADFELTQWPPAGAVLVENASERAYQDMAETGYGYGPAFRGLSRAWTRGDEVFAELALPEEAGKPNGFGVHPALIDACFHAGVFRSSDAERQLVMPFAWNDVRLFAIGATALRVHLTYQGTDTVALRLADAAGAPVASVGSVVARPVGTEQLRSSSDVSGGRMFRVVWDRLSVRSVEVGSGFVRVGSVEEVRALVGGGEVPGVLVLDVVGGERVDAAGVRELAGGVLGVVQAWLAEPVLAESRLVVVTRGAVAVEGEGEGAPVALAGAAVGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRDYLKRVLADARRSQNRVRELESASSEPIAIVGMGCRLPGGVSSPEDLWRLVAEETDAVSGFPEDRGWDLEALYHPDPDHAGTSYTREGGFLDDIAGFDAGFFGVSPREALAMDPEQRLMLEISWEALERAGLDPATLRGKEVGVFTGTGGGGYRSDYQMVPEEAEAYLMVGSLGSVVSGRVSYVLGLEGPALTVDTACSSSLVALHLAAQSLRSGDCSLALAGGVTVMSGPRTIVDSSRQRGLAADGRCKSFAASADGTGLGEGAGVLVLERLSDAVRNGHEVLGVVRGSAVNQDGASNGLTAPNGPSQRRVIRRALVNAGLGAGEVDAVEAHGTGTVLGDPIEAQALLATYGQGRDVGRPLWLGSLKSNIGHTQAAAGVAGVIKMVQAMRHGVLPKTLHVDEPSDQVDWSAGAVELLTEARQWPETGRPRRAAVSGFGVSGTNAHVILEQAPVDEVSVQVSGESPEPGVLAGVQVPLVVSGRGRGGLAGQAGRLAGFLAGRAEGELVDVARSLAVTRGSLVDRAVIIASGRGEAVAGLEAVARGEWVPGVVSAVGEGVSGRVVFVFPGQGAQWVGMGADLLGSSGVFARRLGECARVLDPLTGWSLLEVVRGVGGVSLDGVDVVQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSVRTCGWRRVMWRTGRRWPLFWPPCRPTPR (hide)

Domain analysis:

Biosynthetic assembly:

MeMDHKS

orf_441

Domain Start End Score
Ketosynthase+ 40 113 57.4
1_NysC-Q9L4W3-5mod_cis_ 115.0
19_amphotericin_cis_Mal 113.0
2_amphotericin_cis_Mal 113.0
18_amphotericin_cis_Mal 112.0
7_salinomycin_cis_Mal 112.0
15_NysC-Q9L4W3-6mod_cis_ 111.0
5_vicenistatin_cis_Mal 111.0
16_amphotericin_cis_Mal 110.0
2_meridamycin_cis_MeM 110.0
14_NysC-Q9L4W3-3mod_cis_ 110.0

Detection: predicted by Prodigal
Start: 624616 | End: 624976 | Frame: -

Sequence: show MDDRDVQSGEIVDALRASLKENTRLQRQYDEVVAANSEPIAIVGMGCRFPGGVSSPEDLWRLVIEETDAVSGFPEDRGWDLEALYHPDPEHLGTSYCRESGFLHDTAEIRRGLRDIAA (hide)

Domain analysis:

Biosynthetic assembly:

KS

orf_442

Domain Start End Score
Ketoreductase+ 4006 4186 190.5
Active ketoreductase, cluster 2 2 180 271.9
Inactive ketoreductase, cluster 1 2 180 250.3
Inactive ketoreductase, cluster 2 2 180 183.1
Active ketoreductase, cluster 4 2 180 173.6
Active ketoreductase, cluster 1 35 180 165.5
Active ketoreductase, cluster 6 2 180 138.7
Active ketoreductase, cluster 12 2 180 138.5
Active ketoreductase, cluster 3 34 180 112.6
Inactive ketoreductase, cluster 6 3 180 109.7
Active ketoreductase, cluster 7 2 37 8.1
Thiolation 4288 4355 39.2

Detection: predicted by Prodigal
Start: 625001 | End: 638321 | Frame: -

Sequence: show MEARTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGGCGGGGQGGSVQAENPGRVVRGDVDDAVESGELLGAVSVLDEPQVAVRGGVCFVRRLARVGAAGAEGVGGELDREGTVLITGGTGALGALVARHVIETHGVRNVLLVSRRGERAPGAVELCDELTALGASVRVAACDVADREAMAALLASVPADAPLTGVVHTAGVIDDGVITALTPERLDTVFRPKVDAALVLDELTRGMGLAAFVLFSSAAGTFQAPGQGNYAAANAFLDALAQRRRAAGLAATSLAWGLWSQMNASLNNVDQQRMTRGGIIGLSSEEGLGLFDAALQSPTAALALVKLDFAELRSQAGAGTLPALLRALVPAGRRSAQSATANADGLLQRLAGVSPGEREQILLETVQQAAAAVLGFASPDQLEPERALDEIGFDSLTAVELRNSLSILTGLRLPSTLIFDYPTPMALMAYRDELDGGAVDEIESNEADIRRALATVPIDRLRAAGVLNVLLSLARPEATGQKTVPAASVDEELDLIDGMNIGDLVQRALGNPQS (hide)

Domain analysis:

Biosynthetic assembly:

KRT