Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 3

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_395 CmnD
orf_397 GCHI
orf_398 QueE
orf_399 QueD
orf_400 QueC
orf_407 NR
orf_412 T
orf_416 TE
orf_417 Ox
orf_419 AHBAKR0TKSMeMDHKRTKSMalTKSMalDHKRT
orf_423 KanD
orf02682 DH

Cluster:

         orf_419  

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 1
    (maximum 500)
  • Subgraph combinations: 1
  • Total combinatorial plans: 5 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_395

Domain Start End Score
Capreomycidine synthase 42 309 107.1

Detection: predicted by Prodigal
Start: 549523 | End: 550525 | Frame: -

Sequence: show MALAVREKHVAQPALRLTQDEAGTLWELSEKSVGLLDRSPSADLSEFLPDVPAQLCDALVDFREGTASSGYLLVKGVTTGDLPDTPLAYGTQALVGHASNGTLALVGDVLGSLIGYADEKNGDLLHDVHPVRGEEHRMENSGSVAFDFHTENVHHPLRPDFLGLLSLRQGHEATATRVASIRHAVAHLSEDENAVLRRLRFRSLFPTSFTRGRTGERPATAEHRVLFGNPGQEFLRFDSFNTKPADPEAERALGALAEALEAVCVEVVLEPGDLLLVNNHIAAHGRSAFTPRYDGRDRWLRRFYSHRAPGWARLMMPSKRVLPATGDIQGIF (hide)

Domain analysis:

Biosynthetic assembly:

CmnD

orf_397

Domain Start End Score
GTP cyclohydrolase 26 190 184.0

Detection: predicted by Prodigal
Start: 551637 | End: 552237 | Frame: -

Sequence: show MSIDMDASAITILEQDEAQGGDPLESIARRLLIEIGEDPDREGLRDTPRRYARWWREFVDYDAGNLDTVFSSVASNQIVMVSGMRVWSLCEHHLLPFNCDLQVAYRAHDSLLGLSKFARIAHKHAHKLQVQERLVADIAAEIEEITKSPDVAVIGRGEHLCMTMRGIKTGAQMTSAVFQGVFRENSFERELLSLMNGS (hide)

Domain analysis:

Biosynthetic assembly:

GCHI

orf_398

Domain Start End Score
7-carboxy-7-deazaguanine synthase 100 230 61.3

Detection: predicted by Prodigal
Start: 552237 | End: 552945 | Frame: -

Sequence: show MSIVVNEIFGPTVQGEGPSAGRQCVFLRLGGCNLSCHWCDTPYTWDWKGTSDEKTAFDPRKELHNRDAGEVVEELLALGTGLVVISGGEPLSQQRRLRPVLKGLLEAGVTVEFETNGTVVPDDEIITPGVRFNVSPKLAHAGDPASKRIVPAALTKLAQTTDVAFKFVCRTTDDLDEVGTLQADFGISPIWIMPEGKNVAHISQHLSSLADEVVRRGWNLSTRLHVLAWDKRGI (hide)

Domain analysis:

Biosynthetic assembly:

QueE

orf_399

Domain Start End Score
6-carboxy-5,6,7,8-tetrahydropterin synthase 4 117 110.7

Detection: predicted by Prodigal
Start: 552941 | End: 553304 | Frame: -

Sequence: show MLHITKEFHFSASHRLEHLPSDHQCARLHGHNYIIELKLSAAPDQLTEPGFVRDYGDLADFKKWLDHTLDHRHLNDIIEDRNPSAENMAMWIYDQWTERYPELSAVRVSETDKTWAYRP (hide)

Domain analysis:

Biosynthetic assembly:

QueD

orf_400

Domain Start End Score
7-cyano-7-deazaguanine synthase 1 223 204.8

Detection: predicted by Prodigal
Start: 553308 | End: 553980 | Frame: -

Sequence: show MARVIAIVSGGLDSVVLAHHLHAEGHEVHLLSIDYGQRHRKEHDYARIAADRIGAEHEIVDLSNVASMLPGYSLTDSQVDVPDQHYTAPGSVNVVPNRNVILLSVAYGKAAAVKADQVAIGALAGDASTAPDCSAEFISSFNAMEKIACAGYAPAHLEVVAPFIDLHKHDVIRLGEKLGVDWTETWSCFKGTEVHCGTCAACVDRIQAFERAETTDTTVYFK (hide)

Domain analysis:

Biosynthetic assembly:

QueC

orf_407

Domain Start End Score
Nitroreductase 25 186 74.5

Detection: predicted by Prodigal
Start: 560974 | End: 561601 | Frame: +

Sequence: show MSTDTAAPGLPSLYALSSEARELLFTEARTAYKFTDEPVGDDQLRAIWELFKWAPTASNVNPLRILYVRTPEAKERLVPLIAPPNQPKSASAPVVAVLAVDTGFAEHLPTLFPAVPQLKDAFEANPELREDNASFNSALQAAYFLLAVRAAGLAAGPMKGFDAKAVDEEFFPDGRWRSILVVNIGPAADAWSARLPRLEYEQSVQLV (hide)

Domain analysis:

Biosynthetic assembly:

NR

orf_412

Domain Start End Score
Thiolation 6 74 28.9

Detection: predicted by Prodigal
Start: 567464 | End: 567710 | Frame: -

Sequence: show MSDIESRVSDIMLAKLRVRDPSLDRSDFDKSIYDLDLDSLDVVELTQILERELKVRADRREIANLMLLEEFRSFVLLATR (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_416

Domain Start End Score
Thioesterase 4 222 55.5

Detection: predicted by Prodigal
Start: 570405 | End: 571170 | Frame: -

Sequence: show MTVTDARSALWIRRFEPAPDAPVRLVCFPHAGGSATFFLELAKDLSPDVEVLAVQYPGRQDRRKEPLVETVTGLAESVAAALLPWADRGLALFGHSLGSVVAYEVARLLRDKGHEPVALFASGRRAPSVHRTESGSHADDDTLLRALRSLGGTHPTVFDDEELLRLALPVIRADYVAAETYQYRPGPPLSCPLTMLTGEDDPMVSPQDAAAWREHTSAEFDITLPGGHFYLTEQHAAVTGAITDRLAELTRPV (hide)

Domain analysis:

Biosynthetic assembly:

TE

orf_417

Domain Start End Score
Oxidoreductase 1 500 611.4

Detection: predicted by Prodigal
Start: 571166 | End: 572690 | Frame: -

Sequence: show MVQVNPDDPRYADLQMRGYNRRFVGAPGSVHVVSGTDEVVDVVNSAVRQGRRIAVRSGGHCAEGLVDNPEVDVVIDLSLMDSVSYDPAERAFAAQAGVRLGRLYHVLDMGWGVTVPGGACPEVGVGGHVTGGGHGVLSRLHGYVSDHLYGIEVVVVDDDGTARAVVATREPDDPNRDLWWAHTGGGGGNFGVVTRFWFRAPGADGTDPTTLLPRRPPRHVSAAAMWQWDDFDEESFAALLNNFMDWSARNSAPDTSTAALHAEVAVLHRDCGMLMLTGRVEPSVPGGTKLLDAFLSEVTAGLPEPGMTTSEDEPWLYKVLNVPDAGEAFGLEAARLRSKVKAAYLRKPLDAEQVRTVYRYLTDVDYGYPAAGLMIAAWGGRMNALAPADTAVPQRDSIMQLSLVNSWNDQDADEKHLTWIRLFYRDLFAATGGVPVPDDRTDGSYINWPDTDLLDPEWNTSGVPWSTIYYGDNYPKLQQIKARWDPRGVFRHALSIEPPNPRQGAP (hide)

Domain analysis:

Biosynthetic assembly:

Ox

orf_419

Domain Start End Score
Acyl adenylating enzyme+ 15 418 403.7
3-amino-5-hydroxybenzoic acid 1 403 722.2
Dihydroxycyclohexanecarboxylic acid 1 403 482.0
5-aminolevulinic acid 4 403 213.6
Salicylic acid 1 403 176.3
Ketoreductase+ 816 878 40.4
Inactive ketoreductase, cluster 1 1 62 53.1
Active ketoreductase, cluster 2 1 62 47.6
Active ketoreductase, cluster 24 1 62 37.2
Active ketoreductase, cluster 1 1 62 36.7
Active ketoreductase, cluster 4 1 62 36.0
Inactive ketoreductase, cluster 2 1 62 35.9
Active ketoreductase, cluster 23 1 62 29.6
Active ketoreductase, cluster 12 1 62 28.8
Active ketoreductase, cluster 6 1 59 28.1
Active ketoreductase, cluster 16 1 62 12.8
Thiolation 969 1036 35.8
Ketosynthase+ 1067 1496 595.0
4_divergolide_cis_EtM 657.0
4_hygrocin_cis_EtM 656.0
3_streptolydigin_cis_Mal 655.0
8_tirandamycin_cis_Mal 651.0
1_divergolide_cis_MeM 650.0
5_vicenistatin_cis_Mal 649.0
2_picromycin_cis_MeM 649.0
2_meridamycin_cis_MeM 649.0
8_vicenistatin_cis_MeM 649.0
10_meridamycin_cis_Mal 647.0
Acyltransferase+ 1603 1899 333.6
Methylmalonyl-CoA 3 272 563.9
Methylmalonyl-CoA 3 272 556.1
Methylmalonyl-CoA 3 272 537.1
Methoxymalonyl-CoA 3 272 466.8
Methylmalonyl-CoA 3 272 441.5
Ethylmalonyl-CoA 3 272 435.2
Ethylmalonyl-CoA 3 272 386.3
Ethylmalonyl-CoA 3 272 360.8
Methoxymalonyl-CoA 3 272 325.2
Benzoyl-CoA 3 272 182.9
Dehydratase+ 1967 2104 142.6
Inactive dehydratase, cluster 2 2 135 132.6
Active dehydratase, cluster 6 2 135 127.7
Active dehydratase, cluster 3 2 135 127.3
Inactive dehydratase, cluster 6 2 136 126.9
Active dehydratase, cluster 2 2 135 126.6
Inactive dehydratase, cluster 13 2 136 121.4
Active dehydratase, cluster 4 2 135 118.5
Active dehydratase, cluster 8 2 135 117.3
Active dehydratase, cluster 19 2 135 112.7
Inactive dehydratase, cluster 25 11 63 1.4
Ketoreductase+ 2381 2560 209.3
Active ketoreductase, cluster 2 2 179 274.9
Inactive ketoreductase, cluster 1 2 179 260.4
Inactive ketoreductase, cluster 2 2 179 191.7
Active ketoreductase, cluster 4 2 179 173.3
Active ketoreductase, cluster 1 36 179 162.1
Active ketoreductase, cluster 6 2 179 149.1
Active ketoreductase, cluster 12 2 179 139.3
Active ketoreductase, cluster 5 2 179 133.9
Inactive ketoreductase, cluster 6 3 179 117.3
Active ketoreductase, cluster 7 2 44 10.3
Thiolation 2668 2734 44.0
Ketosynthase+ 2763 3188 603.9
2_hygrocin_cis_Mal 657.0
8_pladienolide_cis_Mal 655.0
2_divergolide_cis_Mal 654.0
3_divergolide_cis_Mal 638.0
9_cremimycin_cis_Mal 638.0
8_vicenistatin_cis_MeM 634.0
3_tetramycin_cis_Mal 634.0
4_streptolydigin_cis_MeM 633.0
2_rifamycin_cis_Mal 632.0
4_tirandamycin_cis_MeM 632.0
Acyltransferase+ 3308 3622 353.1
Malonyl-CoA 3 281 627.4
Malonyl-CoA 3 281 412.0
Methylmalonyl-CoA 3 281 226.7
Methoxymalonyl-CoA 3 281 202.2
Methylmalonyl-CoA 4 281 183.6
Isobuteryl-CoA 3 281 171.2
Methoxymalonyl-CoA 4 281 168.5
Ethylmalonyl-CoA 4 281 136.8
2-Methylbuteryl-CoA 3 281 131.9
Ethylmalonyl-CoA 55 281 101.4
Thiolation 3727 3794 43.5
Ketosynthase+ 3820 4245 594.8
4_hygrocin_cis_EtM 682.0
4_divergolide_cis_EtM 682.0
3_hygrocin_cis_Mal 668.0
8_tirandamycin_cis_Mal 657.0
5_hygrocin_cis_Mal 656.0
6_hygrocin_cis_MeM 654.0
6_divergolide_cis_isobutyryl-CoA 653.0
3_streptolydigin_cis_Mal 649.0
6_meridamycin_cis_MeM 649.0
8_vicenistatin_cis_MeM 647.0
Acyltransferase+ 4353 4649 317.1
Malonyl-CoA 3 276 500.6
Malonyl-CoA 3 276 335.4
Methoxymalonyl-CoA 3 276 203.9
Methylmalonyl-CoA 3 276 163.3
Methylmalonyl-CoA 4 272 119.2
Isobuteryl-CoA 58 276 117.2
Ethylmalonyl-CoA 4 276 108.1
Methylmalonyl-CoA 3 272 105.8
Methylmalonyl-CoA 4 276 104.9
2-Methylbuteryl-CoA 3 276 69.5
Dehydratase+ 4717 4882 235.6
Active dehydratase, cluster 2 2 165 198.8
Active dehydratase, cluster 3 2 165 196.3
Active dehydratase, cluster 6 2 165 195.2
Inactive dehydratase, cluster 2 2 165 192.7
Active dehydratase, cluster 8 2 165 190.4
Active dehydratase, cluster 4 2 165 185.2
Active dehydratase, cluster 19 2 165 180.4
Inactive dehydratase, cluster 6 2 165 167.8
Inactive dehydratase, cluster 13 2 158 159.2
Inactive dehydratase, cluster 1 139 165 5.4
Ketoreductase+ 5182 5360 200.1
Active ketoreductase, cluster 2 2 178 274.5
Inactive ketoreductase, cluster 1 2 178 260.2
Inactive ketoreductase, cluster 2 2 178 186.6
Active ketoreductase, cluster 4 2 178 166.7
Active ketoreductase, cluster 1 33 178 166.6
Active ketoreductase, cluster 6 2 178 145.2
Active ketoreductase, cluster 12 2 178 140.4
Inactive ketoreductase, cluster 5 2 177 114.5
Inactive ketoreductase, cluster 6 3 178 113.3
Active ketoreductase, cluster 3 2 42 8.8
Thiolation 5465 5534 42.5

Detection: predicted by Prodigal
Start: 573608 | End: 590237 | Frame: -

Sequence: show MLRTELVRPLHDLLRAQAARLGRKTAYRDDHRSLSYTDLETRSRRLAGHLADLRLRPGDRAAMLLGNRVETVESYYAIARSGAIGVPLNPRSSDAELAYLLEDSGARVIITDAFHLDQIRRLRATLFPLTVLVVGHEPVPAGTLSYESLAMSEPDSPAYDSLGLDETAWMLYTSGTTGSPKGVLSTTRNCLWSVAACYAPVLGLSAKDTVLWPLPLFHSLSHIACVLSVAATGASARIVDGLSTGDILDIWDDEGFTVVAGVPTMYHRLVREARARGFEAPGLRVGLVGGAITTAELRRSVEETFGVPLIDAYGSTETCGSITINWPSGARVEGSCGLPVVGLGVRLVDPRTGLDVPDGAEGEVWVRGPNVMSGYHNQPEATAEALKDGWYHTGDLARRDDAGYFTVTGRIKELIIRAGENIHPVEVENVLRTVRGVSDVAVVGKPHEVLGEVPVAFVVPTAEGLDPAEAFAACRGQLSAFKVPEELYEIREIPRTASGKTTRRRLLELPARLRAVADTYHESLLRTDWVPRAAQPQSVPGDWALLGREAAQTAPGLESTGARTRAHKDLDALRADVAAGGPAPAVALLAVPAVGRGADALRDSAAELTRWVRTWSADRALANSLLVVATRGAVACGADDLVEPRTAALRGLLCSLQTEHPGNVLIADLDDDLSSHSALPAAVASGDRQFAVRSGVTLVPRPARVATDAGPGVRLSFDEPGTVVVTGADSPRGGAIAEHLADNYSVTRFLLVAAPGRIGLAAETRARLAESGTETLLVECDLTKRSQLKRILAEAAPVRAIVHAAEAGPGHDRLAATIAGARNLRELTRDDDLSAFVLCPSTTTITHPGDAAAAASAAFLGALARQLHAEGVPALSLGWDSDQDTASLTRRQELAAFDAALGAGQPDLAMLELDPEAVTDGSVTPLTQTRAEASAGQAAGEATDGPEAPDAALRWGRLAEDEQKRQLVDLVREQVAELLGLPGPEAVTADRAFKELGFTSAKAVELRDRLARATRLRLPATAAFDHPTPQTLGQRLHRELCGAVEPVEPVEAVEQPSTTASGSDEPIAIVGMGCRFPGGVSSPEDLWRLVAEETDAVSGFPTDRGWDLESLYHPDPDHAGTSYAREGGFLYGAAEFDAGFFGISPREALAMDPQQRLMLETSWEALERAGLDPASLRGKSVGVFSGAMHQGYPDDDTDVPGDAPEGVEGYLMTGGAGSVLSGRVSYVLGLEGPAVTVDTACSSSLVALHLAAQSLRSGESSLALAGGVTVMSGADAFVAFSRQRGLAADGRCKSFAASADGTGWAEGVGVLLLERLSDAVRNGHEVLGVVRGSAVNQDGASNGLTAPNGPSQQRVIRRALANAGLSVTDVDAVEAHGTGTVLGDPIEAQALLATYGQGRDVGRPLWLGSLKSNIGHTQAAAGVAGVIKMVQAMRHGVLPKTLHVDEPSGQVDWSAGAVELLTEARQWPETGGPRRAAVSSFGVSGTNAHVVLEQAPEQVPVGGEQGVLEGPVVPLVVSGRGQAGLAGQAGRLAGFLAGRADDELVGVARSLAGSRSSLMDRAVIIASGRGEAVAGLEALARGEAVPGVVTAAGESTSGRVVFVFPGQGAQWVGMGADLLGSSGVFARRLGECARVLDPLTGWSLLEVVRGVGGVSLDGVDVVQPVSFAVMVSLAAVWEACGVVPDAVVGHSQGEIAAAVVGGVLSLEDAARVVVERSRLIGARLSGGGGMVSVAAGVERVGALLDGFEGVEVAAVNGPRSVVVAGERGALDGLVGVCEGEGVRVRRIPVDYASHSVQVEEIEEELGSVLEGIVPRAGRVPFYSTVTGAPVDTTMLDGGYWYRNLRHTVRFEEATRALAAAGHRVFVEVSSHPVLVPGVEETVEACGVGPVVVTGTLRRNEDGPGRFVEALARLHVRGVGVDWAALLGRDSGWPIDLPTYAFQRQRFWLESGRGAGDPSVLGLAGVDHPLLGARADIPATSGVLFTSRWSAHALPWAADTGAVPAAAFVDLVMRAGDEVGSGVIAELDIEAPLVLPASGGVQVRVTVGGSDDSGKRPVLVHGRREDGEEGAPWIRYASAQLALDEAVPGFEMSQWPPQGPGSGAEIALPEGVEPGRFGLHPVLLEAAARLGHSRTESDAPDGLPCAWRGVRLYATGASRLRAQVMPGASGGFGLRLADVHGAVVASVESVTWQPVDFPESDPGAVWSEDTLFQVTWAESALPRVAGPDEAVRVRTADDVAAWAADGTASDLVVADLTDLRDGLRPLLTRALGLLQAWLAEPTAEGVRLILLTADTDDPVAAAVWGLVRSAQSEHPDRFLLVSMDRPVDDTAWWPPAPAGVLADALASGEPQLAFRSGTVRVPRLARALVRETTTARPLDPAGTVLITGGTGALGALVARHLVGEHHVRNLVLASRRGPDAPEAPALKAELTALGARVRIVACDVADRAVVADLLSSVPQDAPLTVVVHTAGVLDDGVVTALTPERLDAVLRPKADAALVLDELTRELDLAAFVLFSSAAGVFGNPGQGNYAAANAFMDALAQRRRAAGLPATSLAWGYWSSSSEMTAHLSDTDLRRNRSIGMSAISADLGMALFDAGLTATEPALVPAKLDLRGLRAKSASTPVPAMLRGLVTHGRRTASAPAPKGATDLARRLTPLTEADQEEYLLTLISGRAAEILGHSSGEQIEPTRPFREAGFDSLTSVELRNRLAGETGLRLPSTLLFDHPNPRTLARWLRARILGSDLVADDAPEAPAPNPSVDDDPIAIVAMSCRFPGGARGPDGLWKLLLDGTDAIGDFPDDRGWDLDTLYHPDPDHPGTTYTERGAFLTDVAGFDADFFEISPREALAMDPQQRLFLETSWEVFERAGIDPTALRGSGIGVFAGVNTRGYALRLQQRPELVEGHRITGVSDAVLSGRVSYVLGLEGPAVTLDTACSSSLVALHLAAQSLRSGECSMALAGGVTVMTEPDAFVDFSRQRGLSTDGRCKSFAASADGTGWAEGVGVLLLERLSDAVRNGHEVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRRALANAGLSVTDVDAVEAHGTGTVLGDPIEAQALLATYGQGRDVGRPLWLGSLKSNIGHTQAAAGVAGVIKMVQAMRHGVLPKTLHVDEPTGQVDWSAGAVELLTEARQWPETGGPRRAAVSSFGVSGTNAHVILEQASQADGANQADAAEDTAQADAVADTAPEATPVLPWLLSAKSPDALRGQAAELAAHIRRTPAASGTDLAYSLITTRAVFDQRAAVVGTDRDRLIADLERLATGGTLPETLVRDERRPGRLAFLFTGQGSQRVGMGRELYDRYPAYRASFDASCAELDRQLGDAVELPLRDVVFAPPGSDEAARLDSTVYAQSALFALETSLHRLYESWGVRAEFLAGHSIGELSAAHCADVLSLKDAAALVAARARLMQALPGGGAMIAVNAPESEVLPLVAAYPDAVAIAAVNGPASVVISGDTDAVTAVAAELTARGHRTKRLRVSHAFHSPHMDGMLDEFRELASGLAYRSPTIPVISTLTGTVATPDQLCSPDYWVEHVRQAVRFHDGLRTLREHDVTTFLELGPDGVLSAMAQDAVGDPTDGGGFIPSLQRDGDEPLTVVTALARLHARGVPVTWTALFEGASPRRVELPTYAFQHRRFWVDTAPAGAGSPAPDGDVRNSGGGSGTPDTSVRPDGPATQPVKAFEDGSLAAQLAALPESEQNLNLLQLVSEHVAAVLGHDRVDGIEATRAFQSLGFDSLAAVRLQTRLQDTLGVSLSRTLVYDYPSPVELADFLQAELFGHHTAAAADATGALHDPNEPIAIVGMACRLPGGVSSPEDLWELLRAGGDGISGFPTDRGWDLESLYHPDPDHAGTSYAREGGFLYGAAEFDAGFFGISPREALAMDPQQRLMLETSWEALERAGLTPAALRGKPVGVFSGMVNHEYTTRVSAVPEGVEGYLMTGGAGSVLSGRVSYVLGLEGPAVTVDTACSSSLVALHLAAQSLRSGESSLALAGGVTVMSGADAFVAFSRQRGLAADGRCKSFAASADGTGFAEGAGVLVLERLSDAVRNGHEVLGVVRGSAVNQDGASNGLTAPNGPSQRRVIRRALSNAGLSATEVDAVEAHGTGTPLGDPIEAQALLATYGQGRDVGRPLWLGSLKSNIGHTQAAAGVAGVIKMVQAMRHGVLPKTLHVDEPSDQVDWSVGAVELLTEARQWPETGGPRRAAVSGFGVSGTNAHVILEQAPEQVSGESPEPGVLAGVQVPLVVSGRGQAALAGQAGRLAESLARRGEDELFGVARSLVGTRGALADRAVIVASGRDEAVAGLEALARGEAAPGVVTAVGESKAGRLGVLFSGQGSQRVGMGRELYGCFGVFREVFDEVCGVLDARLAGFVEYGVADVVFGVVGGEGLLDRTVYAQAGLFAVEVALFRLVESWGVRVDVVGGHSVGEVVAAYVAGVLSLEDAGALVAARGRLMEGLVEGGAMVAVGAGEEEVVGVLREGVWVAAVNGPSSVVISGVEGEVLAVAEVLAGRGVRTRRLSVSHAFHSGLMEPMLEEFRSVVSGLVLREPRLAMVSNVSGGLVGEGVVVLPEYWVEHVRSAVRFADGVGALREAGVSTVVELGPDGVLSGMGGECVEEPGVFVPVLRGGGGEVRSVVEAVARLHVRGVGVDWGVLVGRGSGFPVDVPTYAFQRQRFWLGSGGGAGDPVGLGLGGVGHPMLGAVVEVPASGGVVFVSRWSVGLFGWLADHVVAGAVLVPGAAFVDVVVRAGDEVGCGVLSELVIEAPLVLPERGGVQVRVCVGEVDGVGQRSVEVHSRVEDAGPGVEWTRHVSGRLAPEVAHADFELAQWPPAGAVLVEGAAERAYREMAETGYGYGPAFRGLSRVWTRGEEVFAEVVLPDEAGGPDGFGVHPALIDACFHAGGFRAGLAGREPRLVLPFAWNDVRVFAVGATALRVHLSFQGPDTITVRMADGTGAPVASVESLASRPVRPDQVRTGSGVINDQLFRVAWGPTSVKRRDGSLNAVSVATADDVRALAAEAEVPGILLLDVVGDDRADAAEVRDLAAQALEVVQAWTAEPALADSRLLAVTHGAVAVAGEEAPVDLAAAAVGGLLRSAQAENPTRILLIDTDDSEASLRVLPDVLASRELYVALRDGVVLAPRLVRAMDVGGANAGRELDREGTVLITGGTGALGALVARHVIETHGVRNVLLVSRRGEQAPGAVQLRDELTALGANVRVAACDVADREATAALLASVPADAPLTAVVHTAGVTDDGVITALTPERLDTVFRPKVDAALVLDELTRDLDLSAFVLYSSAAGTIGNPGQGNYAAANAFLDALAQRRRAAGLPATSLAWGWWGKSTELTGHLDEVDLKRINRLGIVAFTDQEGMELFDTALRAPDAVLVPAKFDFAAMHAQLEPGHLPLMFRGLLKAGRRFAQDEAGGAGKLAEELANATEAEREQIVLDMVQREAVTTIGYLSADDFGPETGLFDIGYDSLTAVELRNRLSELTGLRIPPGIAFEYPTVKELAEQLELLDAAR (hide)

Domain analysis:

Biosynthetic assembly:

AHBAKR0TKSMeMDHKRTKSMalTKSMalDHKRT

orf_423

Domain Start End Score
KanD aminotransferase 11 362 204.9

Detection: predicted by Prodigal
Start: 593300 | End: 594392 | Frame: -

Sequence: show MRALEQGQWWRIGGNEVDLFEEEFAGYHGAQHALAVTTGTHALELALQVLGVGPGTEVIVPAFTFISSSQAAQRLGAVAVPVDVSPDTYCIDVAATADAITPRTRAIMPVHMAGVVSDMDGLGKLAADAGVPLLQDAAHAHGAEWRGKRVGDLGSVAAFSFQNGKLMTAGEGGAVTFPEAEQYERAFVRHSCGRPRTDRSYLHRTSGSNFRMNEFSASVLRAQLSRLDEQIETREKRWPVLSALLARIPGVVPQGDDDRCTRNPHYMAMFRIPGMTEERRNALVDALIERGLPAFAAFRAVYRTAAFWELAAPDESADDIARRCPVSEELTRDCIWLHHRTLLGTEEQMHVIADVVADVLGS (hide)

Domain analysis:

Biosynthetic assembly:

KanD

orf02682

Domain Start End Score
Dehydratase 8 27 10.1

Detection: potential coding sequence
Start: 594712 | End: 594796 | Frame: +

Sequence: show MDRTWEYSGAASPRSTGRRHWRIFSR (hide)

Domain analysis:

Biosynthetic assembly:

DH