Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 27

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_6739 C10TKSMalKRTCSerTC
orf_6740 Ox
orf_6741 AMR84
orf_6742 CutRAMR83
orf_6743 AMR70

Cluster:

orf_6739    

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 1
    (maximum 500)
  • Subgraph combinations: 1
  • Total combinatorial plans: 1 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_6739

Domain Start End Score
Acyl adenylating enzyme+ 8 327 261.8
Long-chain fatty acid 3 316 206.6
α-ketoisovalerate 1 315 206.6
Pyruvate 2 309 180.9
Thiolation 570 636 53.0
Ketosynthase+ 664 1080 472.4
3_stigmatellin_cis_Mal 338.0
5_cylindrospermopsin_cis_Mal 337.0
9_curacin_cis_Mal 337.0
10_myxopyronin_trans_Mal 336.0
6_curacin_cis_Mal 335.0
6_crocacin_cis_Mal 328.0
5_chondrochloren_cis_MeOMal 327.0
2_stigmatellin_cis_Mal 327.0
2_jerangolid_cis_MeM 327.0
1_crystomanamide_cis_Mal 325.0
Acyltransferase+ 1214 1306 78.0
Malonyl-CoA 3 92 80.7
Ketoreductase+ 1807 1977 77.4
Active ketoreductase, cluster 2 2 170 120.4
Active ketoreductase, cluster 6 2 166 113.2
Active ketoreductase, cluster 4 2 170 100.5
Inactive ketoreductase, cluster 1 2 170 90.8
Inactive ketoreductase, cluster 2 2 170 89.9
Active ketoreductase, cluster 1 38 170 79.5
Active ketoreductase, cluster 3 39 169 69.0
Active ketoreductase, cluster 12 2 170 68.7
Active ketoreductase, cluster 14 3 168 61.6
Active ketoreductase, cluster 11 2 39 6.0
Thiolation 2074 2140 57.4
Condensation+ 2160 2470 126.1
fengy4_C2_LCL 93.6
mycos1_C2_LCL 92.4
micro3_C1_LCL 90.9
syrin1_C7_LCL 89.4
tioS_C2_LCL 87.0
bleom6_C1_LCL 86.7
syrin1_C9_LCL 86.3
bacil2_C2_LCL 82.8
tioS_C1_LCL 80.9
ituri1_C2_LCL 80.1
Adenylation+ 2617 3034 336.0
Serine 23 417 358.4
Threonine 23 417 318.1
Lysine 23 417 313.0
Alanine 23 417 309.2
Phenylalanine 23 417 304.3
Ornithine 23 417 298.7
Glutamate 23 417 294.1
Leucine 23 417 293.4
2,3-diaminopropionate 3 417 288.6
Hydroxyproline 7 417 110.9
Thiolation 3165 3228 32.9
Condensation+ 3253 3556 136.0
surfa4_C3_LCL 112.0
grami2_C4_LCL 110.0
mycos2_C6_LCL 109.0
tyroc3_C5_LCL 108.0
tyroc3_C2_LCL 107.0
grami2_C3_LCL 105.0
tyroc3_C4_LCL 104.0
bacit3_C5_LCL 101.0
bacit1_C2_LCL 100.0
tioR_C3_DCL 99.0

Detection: predicted by Prodigal
Start: 7711683 | End: 7723872 | Frame: -

Sequence: show MTLLDVLLDAVREAPGQIVVHVRGDGSELTVTLRELLDDSLRVAGGFREAGVAPGTCVPLLADRSEDFQPMFWGAVAAGLVPVPLAADARRVLPVWEHLGRPPVVVDASTAPLVDELPEGARALALDALREASALREPAPGGRDDVAFLQFSSGSTGAPKGVEVTHRAVLANLEQIRAASALSADDVVVSWMPYFHDMGLIGTHLAPLAARARQVKIGPLSFAKRPRLWFEAADRHRATVLSAANFALALAVRRVPDDVLARLDLSAVRLLLVGAEPIAPAVWRAFAVKTRPAGLDPAAAQPVYGLAEATLAVTFPPPGEVAEPLVLDRASLSDGVAVDTEPGVGAVELMDVGRPVAGCAVRIVDDEGDVLGDRRVGHILVRGPQLARGYHGLPGVSAETFTERWLRTGDLGFLRDGRLCVTGRHKDVLFLNGRTFHATDLEEVVAATPGLPPGAPAVVGSTDPVTGTERVVVFVPWARPPREAAEVLERVAARVREALFHDDVRVLALPPGAFPRTTSGKLQRRRLRERFEAGAFGADAFATRGQPAGDGALSAEPRADVPRARAQTVEAVREVWARVLERPAESIGSHEPFGSLGGTSLKAMEVLVALEDSFGVTLPPAVIRDHGTVAALAGHLLAVVPGPSASAPEAGEAGETPEGGEAVAAVIGMACRFPGADSPEAFWDLLIDGHDAVAPVPYGRWDDDARDRQAAPRKRWAALLEDPAAFDADCFGIGEDEARAIDPQARLFLELAHEALERAGYAGPRRRGRRIGVFAAVGDSGYREVLDRASADGTPLPASLTGNLPALIAARVSQSLDLDGPALAVDTACSSGLVALHLARRSLLDGECDLAVVGGVNLHLTSTPHRLLEDAQALSPTGRSRAFSADADGFVPGEGGAAIVLTRLDAARLSDDQVLAVVRGTAVNNDGRSMSLMAPNPLRQREVITRAYEAAGVGPASVTYVEAHGTGTAVGDPIELRSLAHAFPVRPGGEPRLLGSVKTNIGHLLNAAALPALVKVVLALVHRRLPPSLHHAPPAPGLAPAGFSVVAEARDWTSAGSLVAGINAFGFGGTNAHAVLEEAPALSPEAAPVSPSPGAARETAAEGPHLLTLSARSADALRGAVGRLATHLESRPELREGDVCRTASTSRDEGPHRLAVIADGDLRARLTALVAGAGGAGGAGGHTTTGGAGGRAGTGGSGVLGASVVRSRPRLAFLFPGQGAQSPGQDRALYRTASVFRDTFDEASALLGPVCGRPLLDWGLDPDVDPAVQAVTEVAQPLLVASGVALARQLRTWGVEPEAVAGHSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTFVEIGHGATLSGAVRAATETCAPGGSGGGVTVMSALPGRAADRTNDAPLPDERHGGRGDLLETVGRLWSLGMPLDRSALDAGSRRIPLPTYPFQRRRYWAGPPAPRPLLHRVLWEDDALPGKEAKAAGSVRSVLLTGPDPASVGRLAAQLSAAGVRRYEAGDDGRPDAVVLVAGPAPVQDTGDALDRAHAAASAAFAEALARFDETHADRLLVVTEDVHATGTVRERPRPAHAVLGGLLLALPQKTRRASATALDLCSLDTPSQRLTAVLAELESGGTPGSATIVARRAGRRLTRRLVPLPEPADAPGARRSPLPPDGTFLITGGGGGIGAALARDLAGRGRPTLVLTGRSPGLPVGLADELRTLGATVHYRVADVSVERDVDALLSELPRLDALFHAAGVVRPGTLRNRRPEETADALAAKARGTLLLSLALRRHGLAPAVRVAFSSVSAVLPGLAGALGDYAGANAFLDAFAASERHAGRPWQSVNLAALAGTGMAAALGTGTAAGSPTVRNAGERPVALAPALAALRTACGVDAAQLLLADLTPPSPPRDPEPSEAPTTTAEATGTGTAVPEGTGTGTSTAALLRRLLASALRLPAADVPDDEPFLALGLDSLAAVDLVRQLERELGRSLPATLFFEFRTVAELAAHLDSTPAVIAPALRRTPDPVPDGSPFPLTPVQLALHTSSRLHPDVPAHGYVRQTVRGPLDTRLLGRALAALADRHTMLRIRIENSGGTDGGTGSASAVQYVAPPSDLSTWYEVRELSGRIEELETALCNRPFDLSAEPPVRAVLARESAELSHLVLVIHHAAGDGYSLNVLAGELWSLYTAFAHGDTPTLPALGTDFARYATAAADERSSTDGVEVLAVDRRYWADRLAYRGEPLRLPYDGDPWALPSAPLTTHQSSLDPALTAALEKRAAAHGVSLFHLLLAVHVRCLARWSGQREIAVNVARARRDGRPSGLDRLVGPLADTLPLLCSTDPDEPVGALAERLAGIWLESEQHAGLTGLDLARLLPTDPAGSGPRTVGPAGFSFSRFPAALDERCPVSVRPTAAGTATAATRLSLLCWQDEAILRFSWNYPVRLFAPETVARLDRDFHDELAATALPEAAPLPASGSGSGSATLVRRLVERFRATPDAVAVDTGAATLTYGELDRASQALAASLLAHGVTPGSLVGLLTEPGADTVVAVVAALRAGAGWVPLDAGHPTARLVDQLTRSGARAVLCHAATRAVGEALGDVTLVPVDVPASPFSRDPDSVRYGSGAPTPSAPVDADADGIAYVIFTSGSTGRPKAVPITHRSMENYLDWAIDTFGYDEHDRLAQTASPCFDASVRQLLAPLLVGATVVTVDWDLLRDPDRLLTHVERRRITVWSSVPTLWEQLLSASEARVRSGAPLPDLSALRWVHVGGEALSPTHVRRWFDLFGDGQRIANLYGPTEATINTSCHIIRDRPGDQVRRLPIGRPVSGTEVEVVGPDGEVLRPGEAGELLIAGIGLTPGYLGEPALTEAAFTVRRGRRWYRSGDRVRCSEDGTLEFLGRLDDQVKIRGNRVEPGEIEAVLQAHPDVTHAVVLAEDGRLTAFVTPGPGSSQASGASGSSGASGASGASRADAAALRRHLAESLPAYMIPSRITRVDAMPLTGTGKIDRRALAVLGETPAPSPSRTAAARTAPRTPTEIRLAAIWSALLQADEVCREDDFFVLGGDSLLVLEVFARLEKQGGPLPRPTVIYRNRTLAALASAVDAAAEEVADTTDTAVDYAAVGTGAPAPFPLTPTQRGFLLAEAIAPGTTSSWLTRFRLLGRLDTARFQSAVDTLVGRHPMLRTVFPAGARPAVQQELPSSLRLPVDFETLTDPGQVEERVTAERARRFEPWAWPLLRLRLLTLAPDEHVLVAHAHHIIGDGYSAALLVRELMTTYDALARGEMPAEGALRSTFRDHAVRLAERADATMTDPGVPPRDDRWARLSAPYRPPVLSAGTDTGARPGTAADPLFHTHGFTVDADRVETLRGLAVRTGSTLYAPVLTAYYRALAATTGRADLVLGLAVSGRDHALPDVHRVFGPFATAVPLRPGPASGRMDGTGFEDDLRRLAAEAAEARTYEGAVPSLPNGLPLASQFFFTYLDFSSLGPENGETLTVAREDGHSVFTPPPAGTDVFLAAVPEGGRLRITVRAAATAFTPRALAAFADAVQDGLAHAAASDEPVDAALVGYLPSPADLARLAGLPEAALPREELRRLLFPDGRARLLETLRTPLGRSGFVCVPLFADELAPGDALLGHTTRGVGLASSLGARAVSLAGMIPSLTGYGFDVLRAVGTGGAAPAVTTGHAATVVSVVRTVHAALDATSRQLGSLTVAFVGLGSIGSSSLELLLTLAEEPPARLLLCDVPGSGPRLKELADGLVERGLAAVVEVVESDQGLPDAVYEARLIVAAVSGGGTLLDIDALAPGTTVVDDSFPHCFDTTRALERMERAKDVLVVGGGLLSAGAAERQVAEGLPAAAVAGYLAQPMVADAIASCRLESLLHASGAAVPLVHGPVDAATGLAYWEAAEAAGIRAAPLHLLTRTIGPGMIEGVVSGRD (hide)

Domain analysis:

Biosynthetic assembly:

C10TKSMalKRTCSerTC

orf_6740

Domain Start End Score
Anthrone-type oxygenase 1 84 39.6

Detection: predicted by Prodigal
Start: 7724092 | End: 7724422 | Frame: -

Sequence: show MSVVKINVLTVPQEQRETLEKRFASRAHAVESSDGFEWFELLRPVEGTDNYLVYTRWRDEASFQAWMEGPMKAAHQGGDASGGRPKPAASGSTVWSFEVVQQAAPTGA (hide)

Domain analysis:

Biosynthetic assembly:

Ox

orf_6741

Domain Start End Score
VanS: transcriptional regulator of glycopeptide resistance genes 21 382 299.9

Detection: predicted by Prodigal
Start: 7724460 | End: 7725645 | Frame: -

Sequence: show MAKDEGGAAEDGGTVVAPEGAVARRPGLSVRLKLTLSYAGFLMVAGILLLGAVWVYLLQYVPDDWDQRMLHENPNRQLLAYTFAPAAGTVLGVLLVFGLVGGWFLAGRMLAPLTRITEATRTATHGSLSHRIRLPGRQDEFRELADAFDTMLARLEAHVAEQKRFAANASHELRTPLAVSRTLLEVARADPDRDTGEIIDRLHTVNSRAIDLTEALLLLSRADRRSFTPERVDLSLIAEEAAESLLPLAEERGITLETRGDIAATTGSPTLLLQLATNLVHNAIVHNLSEGGTVQVTTSVRAGSVVLAVENTGVPLAPELVSTLTEPFQRGAERLRTHHAGVGLGLAIVETITRAHDGTLVLAPRPGGGLRATVELPSAGGGDRGRARTPPSP (hide)

Domain analysis:

Biosynthetic assembly:

AMR84

orf_6742

Domain Start End Score
Two-component
Response regulator. neg. reg. of ACT production in S. lividans & coelicolor. Alters copper metabolism
1 217 272.8
VanR: transcriptional activator regulating VanA 1 219 271.9

Detection: predicted by Prodigal
Start: 7725631 | End: 7726336 | Frame: -

Sequence: show MRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDVPGPSGDEIARHIVASGSGTPILMLTAADRLDDKASGFELGADDYLTKPFDLRELVLRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRDGRYVALTRKQFAVLEVLIGADGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATLPGVGYRIRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDVPGPSGDEIARHIVASGSGTPILMLTAADRLDDKASGFELGADDYLTKPFDLRELVLRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRDGRYVALTRKQFAVLEVLIGADGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATLPGVGYRIEAADAVRGDGKNHGQG (hide)

Domain analysis:

Biosynthetic assembly:

CutRAMR83

orf_6743

Domain Start End Score
D-Ala-D-Ala carboxypeptidase 63 233 197.2

Detection: predicted by Prodigal
Start: 7726423 | End: 7727125 | Frame: +

Sequence: show MTRPPPSARTSALRFRKPLVIGLVAVLAAIVVALGHPLLKTSPTPSSNSAATPGQDSSPLLPAPSLSDRPPSHAPHRESRGALDETDGVVPDGATVLDDAVPAVANLDAELLDALRRAARDAAADGVTFTVNSGWRSAAYQEELLRKAIAQYGSEAEAARWVATATTSPHVSGDAVDIGPDRATDWLSQHGSAYGLCRIYRNEPWHFELRTDAADRGCPRMYADPTQDPRMR (hide)

Domain analysis:

Biosynthetic assembly:

AMR70