Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 26

Melanin
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_6552 NR
orf40186 DH
orf_6557 MelC1
orf_6558 MelC2

Cluster:

    

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Error: Unable to generate predicted structure!

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_6552

Domain Start End Score
Nitroreductase 296 454 17.4

Detection: predicted by Prodigal
Start: 7514472 | End: 7515942 | Frame: +

Sequence: show MPDTPVRTAAPVRGAGAVLPAAPDLLCAALVEARSPRVPELSPYAPERPFPWNAPVTAGEPGAVIDLDRVLRLSLAAPVGTPGRLRPVPSAGALHPVRAHLLLGQGCSLPPGRYAHDPRTHRAHLRGPAPDGVRPGALVVLTVAASRTIAHYGHRAWPLLLLDTGHAAAALALAGATRADVLVSLDADGSLLSAAAGLPDAPDWQNIWPGTEPELPLAAVLLTPPGGPSDIDPPLRAWAALPRASAPTPQPGADTTPPCELAAARHLLHHIAEAPGRPGGTWHPASRPGEVTDRALETRRSAPPDDLKRPPGKELLARILATARSVRPDGPDWTVAVGGATPALYAATPGRPGLGVRAVGDARPTLAHWAAGQQWIATSGAVLLAHGCPDDASHATVRSSHLVAGYAAGAAQAHATALGLRSRPIGSWQQADLGAAFGDTPGRDWIVHGLVLGPPTAADSPVTTEATPATPPTASAAPAAPSGEEERP (hide)

Domain analysis:

Biosynthetic assembly:

NR

orf40186

Domain Start End Score
Dehydratase 6 34 8.3

Detection: potential coding sequence
Start: 7522866 | End: 7522971 | Frame: -

Sequence: show VRSAPCSGRVRRATTTSTSPGWRNAWWSWASRT (hide)

Domain analysis:

Biosynthetic assembly:

DH

orf_6557

Domain Start End Score
Melanin tyrosinase cofactor 12 158 56.5

Detection: predicted by Prodigal
Start: 7525010 | End: 7525493 | Frame: +

Sequence: show MSPTPAKPGGTRIPSRRTVLRGAFTAAVVTGTAGALLPLLDRDPAAADRPAPAPGPGSGSGSRATTEEFAEMYRGREIRGTATVVVPAGAPADDRVAVAAEPVTEIRIDGRPLHVMRRADGTYLSDVRHYESYPTLLETARAAVDELGTARLAPPAAHM (hide)

Domain analysis:

Biosynthetic assembly:

MelC1

orf_6558

Domain Start End Score
Melanin tyrosinase 1 287 323.2

Detection: predicted by Prodigal
Start: 7525512 | End: 7526376 | Frame: +

Sequence: show MYTRKNQRDLTRTEKRRLIDAILKLKRSGRYDDFVVMHREYYVMDTERRPRPAHMTSSFFPWHRQYLLEFEKALQRVDAGVSVPYWDWTQDNRTTSSLWAEDFLGGNGRPGDRRVTTGPFAYAAGNWSVGRGVTDEHYLTRNFGRPGSDPVSLPTGNDLARALKDPVYDTAPWNSVSTEGFRNRVEGWGIRGVRTVGLHNRVHQWVGGPMAGAASPEDPVFWLHHSFIDLLWDRWRKAHPKSAYLPGRKPASPGPDRDYVFGLDEAMPPWRVTPRKLLDHSKIYRY (hide)

Domain analysis:

Biosynthetic assembly:

MelC2