Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 25

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_6492 F
orf_6499 PPTase
orf_6509 KSMalT
orf_6510 AmTCLeuTC

Cluster:

  orf_6509orf_6510

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 2
    (maximum 500)
  • Subgraph combinations: 2
  • Total combinatorial plans: 4 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_6492

Domain Start End Score
Formyltransferase 1 234 266.9

Detection: predicted by Prodigal
Start: 7438084 | End: 7439029 | Frame: -

Sequence: show MRVVMFGYQTWGHRTLQALLDSEHDVVTVVTHPRSEHAYEKIWSDSVADLAEKHDVPVIIRNRPDDELVDQLSEVAPDIIVANNWRTWMPPEIFTLPVHGTLNIHDSLLPAYAGFSPLIWALINGEPEVGVTAHMMDEELDAGDIVVQRAVPVGPTDTATDLFHRTVDLIAPVTVEALGLIASGQREFTPQDRSKASFFHKRAEEDIRIDWNWPAEDLERLVRAQSAPYPAAFYHRGRRIEVVSAVVSEGRYGGTPGRVFYREGDGVVIVAGADARTGRNRGLAVTRVRTEDGRELPATEYFTSMGGYLTGRP (hide)

Domain analysis:

Biosynthetic assembly:

F

orf_6499

Domain Start End Score
Phosphopantetheinyltransferase 102 198 28.6

Detection: predicted by Prodigal
Start: 7447072 | End: 7447798 | Frame: +

Sequence: show MIELLLPADVSSAATRAETVPDGTLFPEEEALIAKSVAKRRNDFATARACARRAMAGLGLPPVPVLHGHRGRPLWPEGIVGTLTHCTGYRAAALARATDVLSLGIDAEPHGPLPTGVRELVTLPAERERIGPPAPEGTGEIHWDRILFSAKESVFKTWYPVTGVELDFVEADLTFHRTDTPSPGSGDGSPGPAAAEGFTARLLLTDPALPTTLHGRWRVEDEIVATAVLVRPDWRERDGM (hide)

Domain analysis:

Biosynthetic assembly:

PPTase

orf_6509

Domain Start End Score
Ketosynthase+ 10 441 449.1
9_nosperin_cis_Mal 412.0
6_jamaicamide_cis_Mal 412.0
1_nostopeptolide_cis_Mal 408.0
7_jamaicamide_cis_Mal 403.0
2_patupilone_cis_MeM 402.0
4_curacin_cis_Mal 395.0
1_oxazolomycin_trans_Mal 393.0
5_crocacin_cis_Mal 392.0
1_syringolin_cis_Mal 387.0
1_tallysomycin_cis_Mal 375.0
Acyltransferase+ 548 843 283.2
Malonyl-CoA 58 275 242.0
Malonyl-CoA 3 275 170.3
Methylmalonyl-CoA 3 275 143.0
Methoxymalonyl-CoA 3 275 119.9
Benzoyl-CoA 3 275 99.3
Isobuteryl-CoA 3 275 96.6
Ethylmalonyl-CoA 63 275 88.7
Methylmalonyl-CoA 63 272 84.3
Ethylmalonyl-CoA 63 275 83.4
Thiolation 921 988 45.6

Detection: predicted by Prodigal
Start: 7455741 | End: 7459062 | Frame: +

Sequence: show MGAESRDPSIAVVGMAFRLPGADTPEDLWRVIRNGESRFTRFTRDDLKAAGVPEELYGREDFIGTSAILDDISGFDARHFGMTAREARLTDPQQRLFLECAQHALENAGYPDERDGRRIGVYASAGYHLYNMQSYLMNNVLPNEDIGDWLAGMQVLVGNFTDFNATRVAYRLGLTGPAINVQTACSSSLVGVQLAANSLLLDECDIALVGSGSIHVPQVLGYHYVKGSILSKTGRLRAFDASADGTVGGTGILAVVLKRLDRALADGDTVHGVIRGWGVCNDGSDKKTFAAPSQSGQQKAVRRALDHAGVGADTIGYLETHGTGTLKGDPIELAGASAAYRQDTDRTGYCALGAIKANIGHLDVGAGLAGLVKTLLVLKHGVIPPIAGFSTPNPLLGLESSPFYVPDALRPWPETGTPRRAGVTSLGVGGTNVHLVLEEAPEPAPRTPQAAPPPDVLLVSATSREALADNARSLRDHLRRHTALPAADLVTTAALGRTHGRHRIAVRGATPVHLAEALDDWLARAEKSPEPARDHAPAPDAATRVVFQFTGQGALRPGAAAALYERFPVVREVLDICEEHHRHRTDGSILPILTTGDTDAFDGGLSTATAQPALYALQCALVRLWQEAGIQPSAVTGHSVGEYAALHAAGALSLEDGLALSAHRGRLMRDHCKPGLMVAVMLGREEATELAASCPGVELAVTNGKRSQVLAGPVADMEALCALLTGRDIAHERLGVDRAFHTATMDPMLDGFRAVLATTPFTPVRTPFISSLDGRTRPPGWTPDVEYLLRHVRRPVRYDAALGSVAAEHPDVLLEIGPHTTLSGLARRALPTVRATPSLHRGSGLTALYGAAAALHCAGADVRWEPFLAGTAGRRVPLPGYRFQHRHYWVGEPPRPRATMNPVREERIVTAETTETTHLLDGILGVLSRAFGEELTSVAADTPFFDLGADSLLMINVLREIEEEHQVKVTMRELFDETGTPRLLAELAARLPREHRTAVSAPAPAAAPPPVPQQRAAEPSPVREQSVAEPSAEAPLPASPLPSAGPESASDADDSAFITRKEYRELAARVEQLSRIQLQMLTQLSQLLTLQAGATVSAPAREGVR (hide)

Domain analysis:

Biosynthetic assembly:

KSMalT

orf_6510

Domain Start End Score
Aminotransferase 124 509 507.4
Condensation+ 948 1246 233.2
syrin1_C7_LCL 197.0
syrin1_C6_LCL 192.0
syrin1_C9_LCL 189.0
surfa4_C3_LCL 186.0
Sare2407_1 181.0
bacit2_C2_LCL 180.0
bacit3_C2_LCL 179.0
syrin1_C5_LCL 179.0
micro3_C1_LCL 177.0
bacit3_C5_LCL 174.0
Adenylation+ 1410 1809 309.4
Leucine 23 399 350.3
Phenylalanine 23 399 341.3
Glycine 23 399 317.6
Pipecolic acid 23 399 291.1
Tryptophan 23 399 291.1
Lysine 23 399 290.3
Alanine 23 399 287.2
Leucine 142 399 287.2
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 6 399 285.9
Anthranilic acid 3 399 108.7
Thiolation 1933 1999 58.0
Condensation+ 2009 2309 154.3
syrin1_C9_LCL 143.0
bleom6_C1_LCL 142.0
cyclom1C3_LCL 132.0
cyclom1C1_LCL 132.0
cyclom1C5_LCL 130.0
cdaps1_C7_LCL 129.0
cdaps2_C2_LCL 129.0
cdaps1_C2_LCL 125.0
cdaps3_C2_LCL 125.0
syrin1_C7_LCL 124.0

Detection: predicted by Prodigal
Start: 7459058 | End: 7466384 | Frame: +

Sequence: show MNEQRRLTATLDQDLAAMAGLVQRINEQMNTAPAASPAVSPAASAAVESAEQPRMHGPRVEVAPDAGMVRTGSSRSQQEHLDDLIRRYTARTAASKQLAQRHRRRLADSRAIVGYRRSTKEMLYPVAARRAEGARIEDIDGNSYTDITMGFGVLLFGHEPDFVREAVREHLSRGIRLGPRGVETGQAADLLCELTGMDRVAFANSGTEANAAAIRLARAATGRDRIVTFQGAYHGHADQVLGRQAGKEGTVPVSRGIPGSAVAELTVLEYGSESALHAIEQDAERIAAVIVEPVQSRHPSLRPAEFVRRLRELTARHGIVLMFDEMLTGFRPALRGAQDLYGVTPDLATYGKLLGGGFPIGAVAGRADIMDGVDGGYWSYGDDSGPTADTTFFGGTYLQHPVSMTAAHAVLTHLKERSPRLQERLNARTTELATGLNAFFENEDFPLRMGWFGSQFRFEHRADMELLYPHLMLRGVHVWEWRNFFLSTAHTDSDIEHVADAVRGSLTDLREAGFFRTATTTARRSGHDRPAPATTPRPAPGATATDTGAAPEATAAPAPGTEPRTTTPAVRPPRPAGPAPAPVATASTPSRRADFSLYFFGDYPQEGSGPQEGRYELLMEAARFADEHGFEALWMPERHFNSFGGLFPNPAVLAAALARETRRIRLNAGSVVMPLHDPIRVAEEWSMADNLSGGRVGLGVASGWNADDFVFFPERFGQHKEEMYDRLEEVKRLWRGEALRRTTGDGERDIRLFPRPVQPMPPLYTAVVSNPESYERAAEHDLGIVTNLMTQDVDQLRENIARYRRARSRHGLDPDAGRVAVLLHTYLGADHESARADAFEPMARYMRASLALFSGVTNSLGFSADLKALSEDDLDVVFRRAYGRYCDQRALIGDVDSTLPVAQAVADAGADEIVALVDFGVGAEQLRAGLPRLDALRRRHRERRPAATPQDAPLSSGQERIWFLERLLPGRTAYNEVKAIRLHGPLDTGALHGAVRRLVDRHAGLRTVFRAAGDSAVQVVRDTLEPDFAVVDGVPGAGRTVRDVLTEESDRRYDLENGPLFTTRVVRTGDDEHVLVMAFHHIVVDAASATILCRDLSALYRSELDGTGAGLPEPDWSYADYAREQREAADGPRARQDLAHWLRVLDGDLPVLDLPTDRPRPAVMSSRGRAVFHALDAGLSDRLRRLGRDRRATVFMTLVAGWAAMLHRVTGQDDIVIGVPVSDRPRRADELVGFFVNTVALRVDLTGDPGFTTLLDRVRAVALDAYDHAETPFEDVVRALAPPRSTDRTPVFQVFTEFQSDEPFRLDLPGVRAVPMEAGPDKALTDLTVYFTDRPEGIRCHLEYNTDLFDPGTVDRFFGVFQDLLTAAADGPGTPLSLLSRVRAEGDEVPENWENGPRRPVPDTTVHDRFVQQAAAHPGRTAVLDGDTAVTYGELDERSRRLAAALTPLAAAGDPTPVVAVWLPRGADFVTAVLALARAGFAAVPLDPSLGTVRAAHIIAESGARLVISGPDGARQLSLPAAVRVVAPDAEPAPETAPDTAPRVTNASPCSVIYTSGSTGTPKGVVLSHRSLVDLCRWHHDRFGLTGEHRTAVVCSQSFDASLLEIWPTLTGGGTLVVADDATRRDPLALARWFADRAVDFSVLPTALGEEVLRLPAADQPPLRHLLLGGEALRTRPRPEAPYETVNVYGPTEATVLCLTHTVEPAAGDAPDGRTEAVPIGRPVDNVTVRVVDPSDKPVPIGEVGELLVGGPGVSDGYLHRPDLTAERFTTSAPGTAEGPGYRTGDLVRWRPDGRLEFVGRSDDQVKIRGYRVEPEEVARVLNGLDGIRLAAVVGRRRGNGETFLAAYVVPAEPGAGGAADHERWARELERRLPEYMVPRSWRTLDRLPLNSSGKLDRDRLPSTDPSVPAGSEPEPSAVASPAPAGSPADVARGLRELWAAELDLVADRVDLDASLFDLGGHSLTAMRLINRIRERWGVEYPLSRLYQEPTLRALTAFLAGGTGTRTVVRVGPTTEQQARFANLHSQHARPQVFNVGLRVDISGPLDTTALHGAIQDLVRRHESLRTRLVREDSGGWRQEVLDHEPVDLPMDDLTSRPEAERAEEVRRIVEQASDTVLDPSTGDVLAVRLLRTAAEEWVLLLVTHHCTCDGWAVTTLLKELAALYRAAVTGDGHGLPPAPQQVEFARWQAAYYEATDERRTDYWIEELADASFTLGLPLDRPRPEKLSGMGGVVRFTVPAEVRTAAERLAARRSTTPFAVAAAALSRLLTTRAEQDEVVLNISYAGRDSRAFESLVGCTATGFALRVRARDGTLAELVDRVGRTTVLGMEHAMPPRRVAPAMLRRKGIRIPDQLDIGLAYESSLDTGLELPGLTTTVVEIAPEAARSEFIMVLTPTGDVLEGAVEFSADLWDATTIEEWTRAYVRLLGEEVGEAPREAGD (hide)

Domain analysis:

Biosynthetic assembly:

AmTCLeuTC