Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 22

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_5604 Ox
orf_5605 StzH
orf_5609 Cl
orf_5611 3-HPA
orf_5612 T
orf_5613 NikC
orf_5614 NikD
orf_5615 KSMalTCyCysTE
orf_5616 CThrT
orf_5618 TE

Cluster:

   orf_5611   orf_5615orf_5616 

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 2
    (maximum 500)
  • Subgraph combinations: 2
  • Total combinatorial plans: 9 (maximum 1,000)
  • Scaffolds generated: 5 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_5604

Domain Start End Score
Oxidoreductase 4 516 597.5

Detection: predicted by Prodigal
Start: 6384175 | End: 6385744 | Frame: -

Sequence: show MKRNDQDAEGESGPGSSTPPSSRVTPDDIRYENLRHSYNYRFIAKPDYFRLVHSPRQVEEAVREAVTAGKRITVRSRGHCGEDFVAAPDVEVILDLSPMSRVDYDRERNAFVIEAGAPVGTMLHTLFHDWGVTVPVGFCMGVGAGGHISGGGYGPLSRLLGLSVDHLYAVEVVVVDQDRNVSTVVATREETDPNRDLWWAHTGGGGGNFGVITRYWMRSPEASGAEPAGLLPRPPGALHIAEVSWPWDRLTEADFVRLVGNFTDWQMANSAVDSADADLYALLDCPHRSAGDITLHAHLPEEALRAHARMDAFLAALDAGVGIAPTVRRTSLPWLAASQYLAVPETGPAAIGLRCKVKSADLRAPHRPEQLATLHRHLTRDDYRGTYAAVEYIAYGGKVNAVPSEATAIPRGALLKTFYMVTWKDPAEDDRHLRWIRELYRDMHRATGGVPVPDEVNTGAYINYADVDLADPEWNTSGVPWHTLYYGDNYPRLQEVKAEWDPLDIFHHALSISAPAGRPES (hide)

Domain analysis:

Biosynthetic assembly:

Ox

orf_5605

Domain Start End Score
Streptazone alkaloid aminotransferase 1 526 743.3

Detection: predicted by Prodigal
Start: 6385937 | End: 6387518 | Frame: +

Sequence: show MSSPAGGPVFADRVLNDWLSSVGLGIEYSRAEANTLYYVDEDGQEVPVLDHVCGFGSLIFGHNNPDIVAHAKTVLDRQVPVYVQLSHQSHANDIAAVLHAILRREIPGGDGDYAAIFANSGAEAVEICVKHAELERRARIAKLTEEIARNAEEARGAVGAGRATVAENPYVQFDRASGESDKLEQLLAEAGRRNAELTARGPVHLALENAFHGKLVASVQLTQNPHWRLPFTSLASSTRFLRANRPDEMKAAVEELRTSLLDALVDDGVVTVVERDFPLVGAFFVEPVQGANGMRPLTEAAAREIRAVCDAVGCPLIVDEIHSGMGRTGAFLASSHMGLRGDYYTLAKSIGGGIAKNAVALFHRDRFRPEFEVMHSSTFAKDGFSASIALKVLEMLEADDGRAYRIAAERGDRLKGALTAVAADFPDVVDAVHGIGLMLAVEFKDQTRASSEPLREKAASGMLGYFIAGLILREHHIRVLPVGPAGNSVRFEPSIYLTDADIARTENALRDVCTILRDQEGDRLT (hide)

Domain analysis:

Biosynthetic assembly:

StzH

orf_5609

Domain Start End Score
Chlorination+ 1 393 111.0
tcp21_Teicoplanin_chlorinase_tyrosine_x2 102.0
StaK_A47934_chlorinase_hydroxyphenylglycine 99.4
cepH_Chloroeremomycin_chlorinase_tyrosine_x2 95.1
asm12_Ansamitocin_chlorinase_starter 90.5
Dbv10_A40926_chlorinase_tyrosine,hydroxyphenylglycine_x2 90.5
comH_Complestatin_chlorinase_tyrosine,prephenate_x6 89.7
bhaA_Balhimycin_chlorinase_tyrosine_x2 88.2
StaI_A47934_chlorinase_tyrosine_x2 87.0
sgcC3_C-1027_chlorinase_beta-tyrosine 86.3
vhaA_Vancomycin_chlorinase_tyrosine_x2 86.3

Detection: predicted by Prodigal
Start: 6391428 | End: 6392622 | Frame: +

Sequence: show MSESRYDVIVVGARCAGSPTAMLLARKGYRVLVVDRAVFPSDTLSTHLVHPPGVAALRGWGLLDRLVATGCPPIHTYEFDFGSLVLPGAPGTEAEPYAYAPRRTVLDKLLVDAAREAGAEVREGFTVTGLVLGDAGDVVGVRGRGPHGPEVTERARVVLGADGLHSLVARAVDAPRYNENPKLMVGYYSYFSGLDMDGVFKAHSRPYRSFGAWPTHDGLTLVGGCWPFAEFNDIRKDIEGNYFKNFALAPAWEERIRDARREDRIVGAALPNFFRKPFGPGWALVGDAGYCKDFFTAQGISDAFLSAEMCAGSLDDALSGRAPFDTAMAAYQAARDRHARPVYDFTLQVSTLEPLSPEFEKVLEGIDGNQQGMDAFARVNAGVTSMERFSADGGAV (hide)

Domain analysis:

Biosynthetic assembly:

Cl

orf_5611

Domain Start End Score
Acyl adenylating enzyme+ 40 460 342.4
3-hydroxypicolinic acid 1 420 713.0
3-hydroxypicolinic acid 1 420 693.8
2,3-dihydroxybenzoic acid 1 420 475.5
Salicylic acid 1 420 464.3
3-hydroxyquinaldic acid 1 420 322.0
Quinoxaline-2-carboxylic acid 1 420 284.3

Detection: predicted by Prodigal
Start: 6393967 | End: 6395656 | Frame: -

Sequence: show MNPFENRPLDPDVPVIDRRRAEAYLAAGLWREEGVADLLRAARLRHPDRLALVSGTTRLTHGELHTAVTVAGRRLEGLGVRAGDRVVVQLPNCTEFVVLVLALLDIGAPPVLVLPGFGDYELGHVVRAARPVALAVSAGSRSSGPVESARRLREDHETLDHVLALGDVAAGDVDLAALCDPGAPWDAPVGPVSSAHPRPGRGSALTDAAVFLLSGGTTGPPKVIPRGNAGYAYMIRTACGIADVSREAVYLAVMPAAHGFVLNCPGVLGTLAQGGTVVLSDTTDPRRALGLIERERVTHCALVPTVAMQWLAAAEGTTADLSSLRVLQTGGARPAPELAARIRPALGATLQQCYGMSEGLLSYTGLDDPESVIVGTQGRPASPMDEVLIVDEQGRPVADGTTGELLTRGPYTVAGYYRDPAATAKAFTPDGFYRTGDLATRTPGGDLVVNGRVRDIINRGEKIPAEDLELLVARHPDVRVSAAVGAPHELYGEVVCLYVVPEAGREPTLLELRRFLRGLGLAVWKLPELMESVAQLPTTAIGKIDKKALRADIARRTAVEA (hide)

Domain analysis:

Biosynthetic assembly:

3-HPA

orf_5612

Domain Start End Score
Thiolation 4 60 20.9

Detection: predicted by Prodigal
Start: 6395652 | End: 6395886 | Frame: -

Sequence: show MSVDVLKQLLLDIGIAEQTLTEIEPGTRLRADLGLSSVETTDLEIQLRERFGVRINLWDADYTMEQLAVGIREMPR (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_5613

Domain Start End Score
Lysine transaminase 1 416 718.9

Detection: predicted by Prodigal
Start: 6396239 | End: 6397514 | Frame: +

Sequence: show MERSYEIPYPELGSVLGEQEIGVLTRLVTSGENLSGGRCREEFERCFREYLDVPYALSVTSGTVALEIAIRLLDLNEGDEVIATPQTYKASVQPLLNYPVKVRFCDVEPNTLNIDPGHFASLITSRTKAVILVHYGGLPCDMDAIMAIARRHGITVIEDCAHALGAEYRGRKPGALADIGCFSFHSSKNITTLGEGGMITLFDPALAERADRIRSNDADAVYRAQARTIGNTTSAHPWMLHPGTAFTHDCSTIRYGGTNATLAEPNAAVGTVQLAKLDRLVRRRAEIAAAYTDVLKQHPGVRMHEGPDPVRHAHHLYTFFADPADGILRDRLVSRLDALGVQMQLRYFPMHLLAEWRARGHAAGECPVAERLWFEQQVNLPCHPAMTDRQVGQVVSRLDTVLGQEARDQPIASVTPTAEGWNR (hide)

Domain analysis:

Biosynthetic assembly:

NikC

orf_5614

Domain Start End Score
Picolinic acid cyclase 1 393 723.1

Detection: predicted by Prodigal
Start: 6397510 | End: 6398692 | Frame: +

Sequence: show MSETEHYDIAVIGGGPVGLASAWHAARRGERVAVFEQFSFGNEQCGTSGAERHWRLQYTEPDLCRLTGEALPLWRELERATGHQLLHAFGSLWFGDIDVATNEGRISATARTMDDLSIPYEWLTAADIERRYGFTGLPGHFEGFVQPDGGAVDVRATVEGLLRLTEEAGCALRAHEPVLELIPDSDGVTLRTAHGRCRAGKVVVANGAYANRLLEPLGSRLDLQVFEMALVTLRQRDPKVRYPFWFVFQEPTEEDTNLFYGFPPNAWQDTDTVRVGPVFEVNALADPARATGAPDPRHVARMCAWVERHLPVVDPRPLARDTCLAVLPADPERQFFLGTAKGRFDGGENVVIATGGWGFKFVPLLGRVCADLCVDGATGYRVDRLMLPDAAR (hide)

Domain analysis:

Biosynthetic assembly:

NikD

orf_5615

Domain Start End Score
Ketosynthase+ 19 444 503.2
1_nostopeptolide_cis_Mal 501.0
9_nosperin_cis_Mal 497.0
2_patupilone_cis_MeM 489.0
4_curacin_cis_Mal 488.0
6_jamaicamide_cis_Mal 479.0
1_cylindrospermopsin_cis_MeM 474.0
7_jamaicamide_cis_Mal 472.0
5_crocacin_cis_Mal 456.0
2_oxazolomycin_trans_Mal 445.0
1_oxazolomycin_trans_Mal 439.0
Acyltransferase+ 542 836 320.5
Malonyl-CoA 3 271 358.8
Malonyl-CoA 3 271 333.2
Methylmalonyl-CoA 3 267 203.1
Methoxymalonyl-CoA 3 271 191.5
Ethylmalonyl-CoA 3 268 173.4
Benzoyl-CoA 3 271 170.9
Methylmalonyl-CoA 3 267 165.2
Methoxymalonyl-CoA 3 268 161.5
2-Methylbuteryl-CoA 3 268 132.1
Propionyl-CoA 3 268 101.8
Thiolation 935 999 41.1
Condensation+ 1021 1322 127.7
bleom9_C2_cyc 199.0
bacit1_C1_cyc 194.0
bleom9_C3_cyc 193.0
yersi2_C1_cyc 192.0
pyoch3_C1_cyc 166.0
yersi1_C2_cyc 160.0
yersi1_C1_cyc 149.0
pyoch2_C1_cyc 130.0
bacit3_C2_LCL 57.4
bacit2_C1_LCL 54.7
Adenylation+ 1487 1889 298.5
Cysteine 22 402 720.7
2-methylserine 2 402 489.4
Threonine 22 402 366.4
Methylserine activation 4 402 312.0
Serine 22 402 307.6
Cysteine 22 402 297.0
Modified tyrosine 7 402 291.4
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 5 402 288.4
Histidine 14 402 287.8
6-chloro-4-hydroxy-1-methylindole-3-carboxylic acid activation 2 248 108.7
Thiolation 2009 2072 38.4
Epimerization+ 2085 2321 45.5
bacit3_C6E 66.6
fengy4_C3E 60.1
micro1_C2E 58.2
micro2_C2_LCL 56.2
liche2_C4E 55.5
tyroc1_C1E 55.1
grami1_C1E 54.7
surfa5_C4E 51.6
fengy5_C3E 48.9
bleom9_C1_LCL 48.1

Detection: predicted by Prodigal
Start: 6398745 | End: 6406236 | Frame: +

Sequence: show MVSEAPATGAHHDGTSVDIAVVGMAGRFPGAPDLDAYWHNLRSGVESIERLTEDDLLAEGVDPELIGAPGYVPVAPTLEGIDLFDARFFGFTAREAALLDPQQRLFLESAWHAMEHAGIDPARCGTAAVFAGGNMPAYLMSNLLGGARVVLDSAMFELQIHNDKDYLASRTAYKLGLTGPAVNVQTACSTSLVAVHQAAAALRSGDCEIALAGGVCVRVPHRVGYRYEQGLIYAPDGRCRPFDADGAGTVFGNGAGAVVLKRLTDARRDGDRILAVLKGSAVNNDGAEKVGYTSPSVSGQEAVVAAAIADSGVPARSITAIEAHGTGTHVGDPIEITALSRAFGRHTTDTGFCAVGSVKSNIGHLESAAGIASFIKAVLQLHHRTLVPSLHFERPNPRIDFGSTPFFVNTELRAWPEGEHPRRIGVSSFGIGGTNAHVVLEQAPDPVPAEPSGRPELVVVSAKSPAALDAATEALAEKLAGPDAQPLADIAHTLQTGRGAMRYRRAVVAAGTAEAAALLSGADPGRVRSADAGNAPAKVVFLFPGQGAQYPGMSRGLYAREPVFAEALDTCADLLAEELGIDLRTVLFPDVPDEDGLTHTTLAQPALFATEYAMATLLRSWDVEPDVMVGHSIGEFTAAVLSGVLSLKDAAHLVALRGRLMQDRPTGAMVSIAAPAADIEPLLPAGVSIAAINAPMLCVASGPHEAVAELGETLAAKEITVRPLHTSHAFHSAMMDPVVEPFTEAVAGTPLAAPGLPFVSCVTGEPITAELATDPQYWGTHLRRPVRFADAVRTAIGDGPAVLVEVGPGNTLSTLARAGAGTGGPRCAAVTTMRRPDEAADDGQVLRTAVGDIWLFGGAVDWPALHQGRRNRVELPGYPFQRDRYWIEPRGSATGTPLVAEFAEHEEPETEPTGRATRPSTLVTAYVAPADELEATIAGIWEEMFGIAPIGTRDDFFELGGHSLLAIQVLNRLQATSGVTVELGRLLATPTIGGMAEELRAAGAAGTDDRLPTVVPRPDLRYEPFPLTEMQQAQWIGRLSSFDMGGVAPHLYFEFDSRTIETARLERAWQRVVQRHDMLRMVVLPDGRQQILHDAEPYRFEVLDLRTTDPEESERQLAGIRDRMATEVRPADVWPLWEVRVSLLPDHRVRVHISFDLLVADVSSFFYQLLPQWREFYHHPDRDPEPLALSFRDYVLAEEELRRTPRYERSLEYWRKRVRELPAAPELPTVQGAGGGERLGFVRRHARLDAEPWGRIKAKAGEFGVTPSSAMLAAFAVTIGTWSKSQRFTLNFTAVNRLPVHEEVNDVVGEFASFDLLEVDAVSAPDFAGLVRELQRQSWADFDHRYVSGVRILRERARARGGAGDVMPVVFTSALGSDVDGRPAPSPVDWLGEQSYFISQTPQVTIDHFLLEFGGNLELAWHAVDGLFPDGLMEEMFQAYQDFVVGLAETDGWHRPPVLDLPAGQLAPRAAANDTAGELPDDVLPARILARAGSAEPAVITEGRTLDFAELTGRAVALARELTEEGYGRGAVVGIGLAKGWRQTVAALAASAAGCTYVPLDPGLPEARRRRLVEQAGIGCVLAEPDTATLWPNAPRVLPVAEDARWDPADTAAWSCPARPEDTAYVIYTSGSTGTPKGVAVSHRAALNTLVDIEERFGIRPGDRVLGLSALNFDLSVFDVFGMLAAGGAVVLPETADRRNPDRWTELCRRHGVTVWNSVPALMQMLVEHLESRGPAGEAGHLPGLRLALLSGDWIPLALPDRIRAVAPATDVISLGGATEAAVWSIAHPIGEVDPDWPSIPYGRPLRNQRFHVLNDRLRHAPVWVPGQLHIAGAGLAEGYWRDEQRTAESFITHPETGERLYRTGDLGRYLPDGTIEFLGRDDFQVKIGGYRIELGEIEHALGAHPELLNAVVSAPGERNRQRLVAHVVPADPGTRNDPDFADRLRDHLTTTLPSYMIPSDIVLIDAMPLSANGKVDRSALPDPQRTGNAEAAASAAEDDGEEATGALRTLLVLAADLLGVNRPRPRDNFFELGGDSIMGVQLVGRANAEGIPITPQNLFESTTFLELAAAVPAEPGTDDTGEAVALTPHQTLAHAQVGSVLLDVPDTFDPVPAARALNALADRHPALRTRVRTEEGQRFAVRPGPGEDFDVPEIDLAALPDAVRAAAVEEMIGEMARELDIETGPAVKFAVFRLGERGSVLACTAAQGLMDDASVLLLCRELIQAYDRLAAGRPVVWSDGAGSPQAWNRGLRRKPAHPAGLADTPGTPGELPRRRTVELDATRTADLFTAAAGSHHLDPTEVLVAAASTALGRALPEPPLLVERSLRADLAAGDEPAGRLVGRTTELRTVEPVAAGTPLDTALTSVKGRLRTADPDPVRGAIVAVREVVTWDRVEGAIEVHADFAGVTGLAGWHEETVGQLSAAVVDGALRIRWQLAASVPEDAATRLAEAFDTVLGEIAEHCRRAAEGSYEPSDFPLADLSGDELAEFLDELR (hide)

Domain analysis:

Biosynthetic assembly:

KSMalTCyCysTE

orf_5616

Domain Start End Score
Condensation+ 14 314 189.8
micro2_C1_DCL 199.0
bleom8_C1_DCL 165.0
liche3_C1_DCL 163.0
surfa6_C1_DCL 163.0
compl3_C3_DCL 157.0
fengy2_C1_DCL 154.0
mycos2_C5_DCL 153.0
bacit3_C1_DCL 153.0
ituri2_C5_DCL 152.0
mycos2_C3_DCL 151.0
Adenylation+ 469 884 340.3
Threonine 23 415 485.0
Threonine 23 415 456.0
Serine 23 415 430.1
Phenylalanine 23 415 415.1
Alanine 23 415 403.4
Glutamate 23 415 398.7
Leucine 23 415 384.2
Tryptophan 23 415 371.4
Lysine 23 415 363.8
Threonine 5 274 108.9
Thiolation 1008 1073 46.3

Detection: predicted by Prodigal
Start: 6406282 | End: 6409540 | Frame: +

Sequence: show MTDNGATKRPVRDIADIYELSPIQQGLLYEQLAQPGLGIYVEQLRLEFSGTMHPEHFERAWQLVVDRHPILRTSFHWRKNGSAVQVVHGAARLPLETLDWRDLDERTQEERLRVSLDAERAEGFDLTDVPLMRSTLIRRGDERWTFSWRFSHLLMDGWSFTLAIQDFIDHYRVLCRGGRPTVPPGRPYRDYLSWWRDRDPEEAREFWREELADYRPVEQVHLGGTEIPEGEPTHAHFEQVLGDLAPRLTALARAEQLTLATLAQGAWFVVLGRFLGRTDLACGITMAHRPPDLVGSQDILGPMIATLPLRRRLDPTMQLRPWLREFGKHGIEASGHSAVPLTEMQALLGTDSAIPILQSSVSYENVPMPDFDLADVGAEMTGLVYDGRPHFPITMVIMPGADMPLRVVHDRRKVSDEVAERFAGEVVSVLTQMIERPDVTLGELTFLSTPQPGTAPLTEPDAEPLHETFRRHARLRPEATAVRCGGRALTYRELDAYSDRIAAALRARCPGVTRVGLCLPRSIELVAAMIGVFKAGAAYVPLDPEYPADRLADMLADSAVELVLTDGAPPDALTTGKAELVTLSEADGEDDDSAPPPVPADPDAPAYLLYTSGSTGRPKGVPITHRNVQSLLAAGREVFGFTAEGVWTFAHSFAFDYSVWEIWGALGNGASLVVVDRETGRDPRALARLIAEERVTVLSETPALFEHLVPELADDTSLRRVFLGGERLDPAILRPWFARFGDRDGAGRETTGRAPAPGIELYNLYGVTEATVVSTYHRVREEDVRAGRPVPIGRALPNQRVYLLGEDDRPVPVGATGQLCVAGHAVASGYHDRDGLTAERFGAEPPAGPSSAAFPLYRTGDLATATSDGELHFLGRADTQVKVRGFRVEPGEIEAALRETPGVRSATVTVHGSGTAQRLVGYAVPDAPDAPDAPDAPAAPDAPHTAGPVLTEPLREHLRARLPEHMVPAAVYWIDRIPTTRAVMCMLPPSAYRTSSDRSVIRVETEAERLLAGLLAEVLQVPDVGADDTLGALGLDSLGAMRLAARLRGAYAIDLAVSDLPATRTVAELARAEAARPVAGEGAR (hide)

Domain analysis:

Biosynthetic assembly:

CThrT

orf_5618

Domain Start End Score
Thioesterase 1 201 44.6

Detection: predicted by Prodigal
Start: 6410713 | End: 6411442 | Frame: +

Sequence: show MTEPLRLLCFPYAGGNAQTYVRWRRHLAPDIEVCPMQLPGHGERIGEPPRHRWDDLLADIRTRLAGLTTPRDRPIALFGHSLGALLAFECARILVSEHGIQPARLLVSGHRAPHLPLREETLHHLPDTEFLTRLSERSRTLRALTDPEFRKLLLPMLRADFTASETYAFTEAPTLTCPITALGGERDEDATLGEVAAWQRTTGRFELTAFPGDHFFIDDAWEAVVTTVGDRLRSRVGSTPR (hide)

Domain analysis:

Biosynthetic assembly:

TE