Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 21

Nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_5486 CThr
orf_5487 NMTTECAlaTE
orf_5488 C*Ser
orf_5490 GlyTCHpgNMTTCAlaTCTrp
orf_5491 TE

Cluster:

orf_5486orf_5487orf_5488orf_5490 

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 6
    (maximum 500)
  • Subgraph combinations: 6
  • Total combinatorial plans: 28 (maximum 1,000)
  • Scaffolds generated: 16 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_5486

Domain Start End Score
Condensation+ 16 308 213.2
compl3_C5_DCL 269.0
act3_C1_DCL 263.0
compl4_C1_DCL 262.0
cdaps1_C5_DCL 258.0
cdaps3_C1_DCL 257.0
compl2_C1_DCL 247.0
compl3_C1_DCL 247.0
cdaps2_C1_DCL 245.0
compl3_C3_DCL 242.0
compl1_C1 229.0
Adenylation+ 469 583 109.1
Threonine 23 114 140.9
Phenylalanine 23 112 138.4
Asparagine 23 105 131.2
Alanine 23 113 131.0
Aspartate 23 112 130.8
Tryptophan 23 114 130.1
Glycine 23 114 128.5
Proline 23 114 128.0
Ornithine 23 114 122.8
Cysteine 23 113 108.7

Detection: predicted by Prodigal
Start: 6226493 | End: 6228248 | Frame: -

Sequence: show MGDLTVEKTLRSKPRIENVLPLTALQEGLVFHAAYDDRAPDVYNVQLGIDLEGPLDGGVLRAAAEALLDRHGNLRISVRRRPQGDSVQVVQSHVVLPWTEAVVGNEAEADAIARADRERRFTLSTAPLLRFTLVRLGHNRHRFLFTTHHLLLDGWSMPLLMQELFTLYGNHADPRSLPPATPYENYFRWLTAQDTPTAETAWRTALTGLDEPTRLTPHADSHASVTPHHRVVALPPELTQTLTGQARRHELTLSTVVQVAWGLLLARLTGRQDVVFGATVSGRSPEVPGIETMIGLFINTLPVRVRLQPDETLLNLATRLQREQAELSAHQHLGMADIQRQTDITGELFDTLVVFENYPLDPEALSEAHGLRVTGLHPHNDVHYPLALIALPGDRLTLDFTYRPDLYSESDIDDLVKRFTRVLTSVAEATPRLLTRDVGLLTPEEQRQAVTEFNDTAREVTTAAVHELFEEQARRSPEAVAVVFEDEEVSYARLNASADDLARTLQSLGAGPEHLVALLVPRSVEMVASMLAVLKTGAAYLPIDPDYPRDRIAYMLDDAAPALVVVTDATQHLVEATGRPRVV (hide)

Domain analysis:

Biosynthetic assembly:

CThr

orf_5487

Domain Start End Score
N-methyltransferase 1 217 325.7
Thiolation 422 484 49.1
Epimerization+ 508 811 157.0
prist1_C3E 217.0
act2_C3E 210.0
cdaps1_C4E 204.0
compl3_C4E 191.0
cdaps2_C4E 184.0
tioR_C2E 179.0
compl3_C2E 164.0
micro1_C2E 160.0
fengy1_C4E 141.0
surfa4_C4E 140.0
Condensation+ 989 1281 217.5
cdaps3_C1_DCL 279.0
compl3_C5_DCL 278.0
cdaps1_C5_DCL 276.0
act3_C1_DCL 275.0
compl4_C1_DCL 272.0
cdaps2_C1_DCL 263.0
compl2_C1_DCL 260.0
compl3_C3_DCL 248.0
compl3_C1_DCL 245.0
compl1_C1 239.0
Adenylation+ 1442 1838 327.6
Alanine 24 396 494.4
Phenylalanine 23 396 441.4
Aspartate 23 396 418.9
Piperazic acid 9 396 416.0
Glutamate 23 396 403.7
Arginine 23 396 391.6
Hydroxyacetyl-ornithine 23 396 376.3
β-hydroxy-asparagine 1 396 357.1
Modified tyrosine 7 396 348.6
Valine 23 117 110.2
Thiolation 1947 2010 49.2
Epimerization+ 2033 2336 160.7
prist1_C3E 216.0
act2_C3E 211.0
cdaps1_C4E 210.0
compl3_C4E 189.0
cdaps2_C4E 180.0
tioR_C2E 179.0
micro1_C2E 166.0
compl3_C2E 165.0
surfa4_C4E 145.0
fengy5_C3E 145.0

Detection: predicted by Prodigal
Start: 6228235 | End: 6235789 | Frame: -

Sequence: show MEAWRTDTVERIRSLRPRRVLEIGVGSGLLLSRLADATEAYWATDFSAAVIERLRRQTAARPELSGRIELLARPAHELDGLPREFFDTVVINSVAQYFPNVDYLTSVLRGAADLLAPGGSLFVGDVRNLRLKGALDTAVQLARSSRDADTAAVRRAVDQRAAQENELLVDPEFFHALAAGDAERFGGVDIRVKTGAYDNELVRHRYDVVLRTRSGPPSVSAAGAPRWQWGEDVGTARELVDRLAGERPDRVRVTGVPNGRTAHEAAAARALYTGAPLAEVRAALLRTGAPGATSDALVELGERLGYRVAVTWSSEGTDGELDALFLPPGTGPLTDVYLPAEDRRAGRPSTNNPALGHVAGELSASLRGHLRDMLPDYMVPSAVVVLDSLPVNTNGKLDRRALPAPDFQAQVTGRTPRTAREELLCGLFAEVLGLPAVGIDDSFFDLGGDSISSIQLVGRAQRAGLAISPRDVFRHKTVLALADIATPLATAVGERPEDGVGEVRWTPIVHHLRELGGPVRRFHQSMVVRVPTGVREDLLSDALQSVLDHHGALRLRMTDKDGEWTFEVTEPGTVTAGPLIRRTDISGLTADERRSVLTEQTAEAADRLDPTAGVILQAVWCDAGHDPGHLVLVVHHLAIDGVSWRILLPDLAEAYTAHANGQPPTLQPVATSLRQWAEALHGLAHSPEREAELPLWSGILAGADPLLGRRAPDPTRDVFARRRTLTLTLPDTWTTEVLTNVTKTFHTEVNEVLLTAMALAVQDWRHRRQLPGSTVLLDVEGHGREDITDTNDLSRTIGWFTTLFPLRLEPHVTNWDELWAAGPATGTALKHIKEQIRALPDHGIGYGLLRHLNPTTTPTLTNTPRPQIGFNYLGRFTTTTANDWEPDHEHGGFSGGADPQLPLAHPLELNALTQDTPQGRHLIAHWTWAEDIFSEQDIHDLAHTWFKALETLATHARTPDTGGHTPSDLPYVTLTQDDLEELERDTPDLVDVLPLTALQEGLVFHAAYDDRAPDVYNVQLGIDLEGPLDADVLRAAAQALLDRHGNLRAGVRQPGRVGHVQVVRARVDLPWAEADAADEAEADRLAQEDRSRRFDLEDPPLLRFTLVRLGHNRHRFLFTTHHLLLDGWSMPLLMQELFTLYGNHADPRSLPPATPYENYFRWLTAQDTPTAETAWRTALTGLDEPTRLTPHADSHASVTPHHHSVRVPRELTEAVTRQARRHGITLNTVVQATWGLLLARLTGRQDVVFGATVSGRSPEVPGIETMIGLFINTLPVRVRLQPDETLLNLAARLQREQAELSAHQHLGMADIQRQTDITGELFDTLLVFENYPLDPDTLSGAPGLRVAGLRTHNDVHYPLALLALPGDELTLDFGYRPDLFTEAEVALLGERCTRLLRTFAEAGPDLLADDVDVLTERERHQVLEGWSGAGRTGPVPGVVERFEAAVAATPDAVAVVCGPVRLTFAELDARANRLARVLRARGVGRGDLVAVALARSADMVVAVFAVLKAGAGYVPLDAAYPADRIAFMLDDAAPRLVITDRSVSGGLPDTRVEALVLDDPACLRELAAVPDGRLPDEELGGAVPEGATAYVIYTSGSTGRPKGVIVPRRAMAVFLSWAVEEFGPEGLESVLASTSLSFDVSVFEIFAPLLAGGRIEVVPDLLALAGRPWSGSLISGVPSVVAALLEAGARLDCDRLVLAGEALPEHVVRRLRTDAPHVRVANLYGPTESTVYASGWHESDPDEVLAPPIGRPLSGTRTYLLDGRLRPVPAGVPGDLYLAGPKVADGYLGRPGLTACHFLPDPWGPAGARMYRTGDLARWDEHGMLHYLGRADHQVKVRGFRIELGEIESVLARHPEVVRAAATTHAAGTGEHRLVAHVLTAPGSRPSQEELARHLTSALPAHMVPSAFVHLDSLPVNANGKLDRSALPAPDFRTGGSGRVARNTREEVLCALFGEVLNVDAVGADDSFFDLGGDSISSIQLVSRARKAGLVITPKDVFDFRTVAGLAEAARSTGAVVVERPEDGVGEVALTPIVHHLRELGGPVRRFHQSMVVRVPAGVREDLLSDALQSVLDHHGALRLRMTDKDGEWTFEVTEPGTVTAGPLIRRTDISGLTADERRSVLTEQTAEAADRLDPTAGVILQAVWCDAGHDPGHLVLVVHHLAIDGVSWRILLPDLAEAYTAHANGQPPTLQPVATSLRQWALRLQSIARSPRRTDELELWSGILAGADPLLGRRAPDPTRDVFARRRTLTLTLPDTWTTEVLTNVTKTFHTEVNEVLLTAMALAVQDWRHRRQLPGSTVLLDVEGHGREDITDTNDLSRTIGWFTTLFPLRLEPVTNWDELWAAGPATGTALKHIKEQIRALPDHGIGYGLLRHLNPTTTPTLTNTPRPQIGFNYLGRFTTTTANDWEPDHEHGGFSGGADPQLPLAHPLELNALTQDTPQGRHLIAHWTWAEDIFSEQDIHDLAHTWFKALETLATHARTPDTGGHTPSDLPYVTLTQDDLDQFQEELDEAWEI (hide)

Domain analysis:

Biosynthetic assembly:

NMTTECAlaTE

orf_5488

Domain Start End Score
Condensation+ 5 301 155.8
AryB_-_Arylomycin_C-starter 587.0
Skyllamycin_C-starter 214.0
bacil2_C1_start 189.0
HrmO_hormaomycin 187.0
LpmA_-_Laspartomycin_C-starter 187.0
act2_C1_start 171.0
GlbF_-_Glidobactin_C-starter 171.0
EpxD_epoxomicin 169.0
EndA_-_enduracidin_C-starter 162.0
griE_griseobactin 157.0
Adenylation+ 464 817 290.8
Serine 23 350 593.8
Alanine 23 350 484.9
Glycine 23 350 416.9
Arginine 23 350 401.6
Glutamate 23 350 399.6
Phenylalanine 23 350 371.0
Glutamine 23 350 369.5
Ornithine 23 350 368.4
Tryptophan 23 350 367.3
(4R)-4[(E)-2-butenyl]-4-methyl-L-threonine 136 350 108.8

Detection: predicted by Prodigal
Start: 6235793 | End: 6238694 | Frame: -

Sequence: show MSASPDRQLALTSAQTGMWLAQRFAADRLDYSIAQYVEIRGPLDTGLFVRAARRAFDEADAVRVRFVETQDGPVQLLAPDRACAVPVLDFTDRSRPEEAARRWMADELDRPLSLEEGRVLSLALLKVSEETHYWYLRGHHAVLDGYSGSVLVRRAADVHRALVAGDPVPECPYGTIEDLLSHDRDYRESPAFAADRAYWAETLTGHRSPASFGHSGRGRTPGRIRVSAPLEPELIDALRGVAASCGVSLPALFVAVELLHVARLTGERDIVLGLPVTARTKAVRATPGMVSNVVPLRLTVAPDESLSGLLGRIWKAMRRCLAHQRYRFEDIRRDLRLSDAGEPLTGPHVNLQIFDYELDFAGSPASVHNLTNGPVEDLALVVYSGTADAPWRVDLDANAELYAAEDLAVHQEAVLRLMAGLAGAGTDTPVGTLDVLAPEEERRLLTEWNDTAHPFPDTTLPELFEAQAARTPGGDAVVHRGEAISYETLDARADALAHVLRGLGAGPEGVVALAVPRSHELIVSLLAVLKTGAAYLPLDPDHPAERIAAMLADARPAVLVTTTAALGRLPAAQTPPRLLLDDPATLAVLREAPSSRPAGDTAVRPHPRNPANVIYTSGSTGTPKGVVNTHEGLVNRLLWMQDRYGLDATDRVLQKTSCGFDVAGWEFFWPLITGATLVVAEPERHKDPAYLAALIAEQDVTTVHFVPSMLKGFLAEPTTAGCVSLRRVMCSGEALSADLVARFHALLGCELHNLYGPTEAAIDVTAFACDPADASGSAPPIGTPIANTRVYVLNRALRPVPAGVMGELYLAGHRPGRLPRPCPAHRRAVRGMPVRPFGLPHVPHRRPRPLGRLRAARLHGPRRRTGEDPRGPRGARRDRRRPRRPPGRGRGRGRRPRRRPRRHAPRRVRGARLAVPGGPYGTGPAGEGRAVGTALPDHVRHHAGGGLRRGLHRLGQQLRRNTPPP (hide)

Domain analysis:

Biosynthetic assembly:

C*Ser

orf_5490

Domain Start End Score
Adenylation+ 2 270 247.3
Glycine 1 268 473.4
Glycine 7 268 472.6
Serine 2 268 372.6
Phenylalanine 2 268 366.8
Arginine 1 268 351.4
Aspartate 4 268 348.9
Ornithine 2 268 347.8
Tryptophan 3 268 336.6
Threonine 3 268 334.4
4-methyl-proline 2 268 109.8
Thiolation 381 445 53.9
Condensation+ 461 763 225.9
act3_C3_LCL 355.0
act2_C2_LCL 351.0
prist2_C3_LCL 341.0
act3_C2_LCL 340.0
bacil2_C2_LCL 334.0
cyclom1C2_LCL 322.0
cyclom1C4_LCL 321.0
cyclom1C1_LCL 321.0
cdaps1_C2_LCL 321.0
cyclom1C3_LCL 317.0
Adenylation+ 948 1344 337.1
Hydroxyphenylglycine 24 396 600.2
Valine 25 396 549.3
3,5-dihydroxyphenylglycine 24 396 437.4
Serine 24 396 437.1
Leucine 23 396 429.3
Glutamate 25 396 423.0
Tryptophan 24 396 421.5
Alanine 24 396 414.6
Phenylalanine 24 396 413.0
α-ketoisovalerate 4 396 108.5
N-methyltransferase 1435 1652 337.7
Thiolation 1860 1924 54.8
Condensation+ 1939 2242 228.5
act3_C3_LCL 341.0
prist2_C3_LCL 332.0
act3_C2_LCL 332.0
act2_C2_LCL 328.0
prist2_C2_LCL 327.0
bacil2_C2_LCL 320.0
cyclom1C2_LCL 316.0
cdaps2_C3_LCL 316.0
prist2_C4_LCL 309.0
cyclom1C4_LCL 308.0
Adenylation+ 2412 2806 338.1
Alanine 23 394 533.7
Phenylalanine 23 394 464.3
Arginine 23 394 438.6
Aspartate 23 394 435.9
Piperazic acid 9 394 424.1
Glutamate 23 394 419.0
Hydroxyacetyl-ornithine 23 394 405.9
Hydroxyphenylglycine 23 394 403.2
β-hydroxy-asparagine 1 394 361.8
Glutamate 5 222 110.4
Thiolation 2915 2979 48.9
Condensation+ 2994 3297 210.4
act3_C3_LCL 356.0
act2_C2_LCL 346.0
act3_C2_LCL 343.0
prist2_C3_LCL 328.0
cdaps3_C2_LCL 322.0
cyclom1C4_LCL 320.0
cyclom1C2_LCL 320.0
bacil2_C2_LCL 318.0
cdaps1_C2_LCL 317.0
cdaps2_C2_LCL 317.0
Adenylation+ 3465 3812 274.5
Tryptophan 23 345 501.8
Phenylalanine 23 344 483.1
Tyrosine 23 345 423.7
β-hydroxy-phenylalanine 1 346 402.5
Alanine 23 344 375.6
β-methyl-phenylalanine 1 347 370.6
Lysine 23 345 370.4
Leucine 23 345 365.9
Hydroxyquinaldic acid biosynthesis 2 347 361.7
Methyl aspartic acid 1 347 109.3

Detection: predicted by Prodigal
Start: 6240550 | End: 6252721 | Frame: +

Sequence: show MPFEPSNHAHSGNPAYIIYTSGSTGAPKGTVVTGENLVNLLSDFRSRLSFGAEDRLLAVTTFGFDISNLELLLPLISGGRVVLASKETSQDPNALGGLIAASGATVMQATPALWQTLLASGDPEGLRQVKVLVGGEALPRPLAGALRDSAREVTNVYGPTETTIWSTAAFLDEENADRPPIGLPLANTRAYVLDSALRPVPAGVAGELYLAGAGVARGYLNRPALTAQRFVADPFGPAGGRMYRTGDLVRRHADGNLEFLDRVDHQVKIRGFRIELGEIEGALNQHPAVARAAVVVHEDQAGEKRLVAYTVPAPGHDAADTASLRAHLAGQLPAHMVPSAIVGLDVLPLTPNGKLDRKALPAPDFASAAGAGRGPRTPQEEILCGLFAEVLGLPSVGAEDDFFDLGGHSLLATRLTNGVRARLGVEVPVRAVFEAPTVRALATRLAGGDRARPALTAADRPAELPLSHGQRRLWFLNRLEDGDAAYNIQATLRITGDLDRTALADALADLAARHESLRTVHPEAGGEPRQVVLDATTARPALTVTPVNEERLPAELARASAVGFDLGTELPLRAHLFPLAPDEHVLLLVLHHIAGDGWSMAPLARDLGAAYSARLAGVAPDWAPLPVQYADYTLWQRRVLGAEDDPDSALAAQTDFWRRTLDGLPEQLTLPTDRPRPRKLSFRGDTVDIELDAELHARLLDIAQRHNVTLFMVLQAAVATLCTRLGGGTDIPVGSPISGRTDAALDELVGFFVNTLVLRTDTSGDPRFSDLLRRVRDTALAAYSHQDVPFERLVELLNPARSLSQHPLFQVFLALQNNAEAELALPGLSVAVEPDALRPAKFDLAFNIAESFGEGHTPGGITGVLEFSTDLFDRDTAAGLVQRLARILTSVAEDPRRHIGAIEILTAGERDRLLGIGTASGRPAGPGDPGHPAADRRLHTATTLHERLHEITADAPDAPAVRAGDRELTRGDLDDRANRLAHRLIKLGVRPETRVAVFLERSPELAVAVLAVLKAGGTYVPLHEAFPAERLEWVMADTRSRVLLTDRAMLSRRFDHDATVVVLDDEPLDDEPVPSGAPAVRVHPDQLAYIMYTSGSTGLPKGVAVAHRDVLALAADPCWDTGHHERVLLHAPYAFDISDYELWVTLLVGGLVVLAPPGRLDTGTLARLIEQEKITAVHFTAGLLRVLAEDEPGCLARVREVLTGGDVVSPIAVQRVLEHAPDTVVRQLYGPTEVTLCATQHEVRAPFEAGATVPIGRPLADTRVYLLDDLLRPVPQGVTGEVYLAGAGLARGYVNLPGRTAEQFVADPFGPPGSRMYRTGDLARWNTDWLLEFAGRADHQVKVRGFRIEPGEVAAAVARHPDVREAEVLARPDHLGEQQLVGYVVADPQRMGDRVESATREQVTEWQQIYDGMYGRATGAGFGEDFDGWDSSYDGEPLPLEQMREWRRSIVDRVRALNPRRVLEIGVGSGLILSQLVGECEAYWATDFSSAAIAALRDRPELDGHVELRVQPADDVDGLPEGYFDTVVISSVTQYFPHAGYLESVLEKVVGLLAPGGAVFVGDVRNLTLLRSFHTGVALARTPDPADASEVRRDVDRRVLREKELLVAPAFFQRFGAGNTLVGGVDIRVKSGGFHNELSRYRYDVVLHRKEPRDLFTAPSAPVLTWGDDITGLAALREALAAGRPETLRVSGVPNARTAAEAAAARALLAGEDLAGIREAARTGGIDPEALTALGAELGYRTALTWTDGDTEGRLDALFAAAPEVSPAPPLVTHGAHDGPRVHRGALTNTPVAFRESGSLTASLREYLRDWLPDYMIPTAFVVLDSLPVTENGKLDRALLPVPDLVADVRGGAPRTPEEETLCRLFAEVLGVPGVGVDDGFFALGGHSLLAIRLVNAVRAALGVELTVRAVFEAPTVAELARRLGPADRTRPALVPWDRPDVVPLSYAQRRLWFLNRLGEAGGAYNIPVALRLSGDLDRQALARALRDVVVRHESLRTSFPEHDGEPRQLVHDPADVTVGLDVVAADEETWRAAVAEAGAYGFDLTRELPLRATLFPLSRTEHVLLVVLHHIAGDGWSMGPLARDIATAYAARSGNAEPGFPPPAVQYADYTLWQRAVLGSEQDPGSRMSGELAHWEAALAGLPAELDLPTDRPRPAEFSYRGGSVPLTIDPALHDRLARLARDHHASLFMVLQAGLAALLTRLGAGTDIPVGTPVAGRDDTALDDLVGFFVNTLVLRTDTSGDPGFGELLGRVAEADLAAYGNPHVPFERLVEVLNPPRSLGRHPLFQVMLALQNNAEPDLHLPGLRVGVPDIDLASVKFDLDVQLAESFDESGEPAGITGRIAYSADLFDEDTVASLGRRLVRLLTAVAADPALPLTAVDILAPDERTRIVEEWSGTAGPGPVTDVVEAFERTVAASPRSTAVVSGGTTLSYADLDGRANRLAHLLRARGVRPGDLVAVALPRGADMVVAVWAVLKTGAGYVPVEPAYPAERIAFMLADAAPGLVVTDTKAADRLPDTASAEVVVLDGDDTVHELAGLPGTPLTHRAPVPGATPAYVIYTSGSTGRPKGVAVSRRSMSVFLSWAVRSFGAEGLAKVLASTSLSFDVSVFEIFAPLLAGGSVEVVTDLLALAERPWSGTLISGVPSVVSALLDAGAPLDCDRVVLAGEALPEHLVRRLRQHAPGVRIANLYGPTESTVYATGWYEAAPGQVCAPPIGQPLPGTRAHVLDARLRPVPAGVPGELYLAGPKVADGYLGRPGLTARHFVPDPHGPAGSRMYRTGDLARWDADGVLHYLGRADQQVKIRGFRIEPGEIESVLARHPAVTHATVTTAPAPTGEHRLVAYLTTAPGTHPTHDELVRHVTATLPEHMAPVATVVLDALPVTANGKLDRKALPAPDFGTAAQGRAPRTPAEELMCALFADVLGIPHVGADDSFFDHGGHSLLATRLVNAVRTAFGAELTLRAVFETPTPAGLVEALPSAGTARPPLTPAERPERIPLSHAQQRLWLLNRLEGTGDAYNVPMALRLTGPLRLDALQAALTDLVDRHETLRTVYPDVRGVPSQVIRDTAAAAPRPTVTDTTEERLPAALVEAAKHAFDLTADLPLRAFVFRLGREEHVLLLVLHHIACDGASLAPLATELGAAYRARLSGAAPDWAPLPVQYADHTLWQRAALGSEDDPDSLVARQLAYWRTALAGLPEELPLPADRPRPAVRGHLGGTVTAEFDASLHHRVRELARLTGATPFMVLQAGLAALLTRLGAGTDIPVGTPVAGRGDTALDGLVGFFVNTLVLRTDTSGDPAFAELVRRVRQNTLAALAHQDVPFERLVEALNPERSMSRHPLFQVLATVRDHRPPTADLAGTSATEVAVDPGVAKFDLEFTFGETFEATTPAGIAVELRYSKDLFDDITAQELVTRLSRLLDDLTAGPENPIGAASVLLPHEARAAENRAGTGAAVPEDTVTTLFEARAALTPDAIALRSGATTLTYAELNRRANRVAHTLTGLGIGPESFVALALPRSADQITALLGVLKAGAAYLPVDPDYPAARVRAMLDDARPALLVTRRDTLGALPAPLPGDTRVLTLDEPGTAAAIEAAAGTDPTDADRTAPLRHDHPAYLIFTSGSTGRPNGVVVTHTGTANLAARQIERFRVGEGDRMLQFASPSFDAAFSEVCTALLPGAELVLADKDELTPGRPLAELLIRHRITHVTLPPAALPLLPPEALASVTTLVTAGDALPRDAVRRWGPGRRLVNAYGPTEATVCATMSEPLTGDDEPTIGGPLGGARVHVLDDRLRPVPPGVTGELYIGGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDCSARCSRRCSAYPGWASTTASSPWAATRCWPQGSSAACTRRSVSRSACGACSRRRPSPNSPNGWGRTPARVGASSTS (hide)

Domain analysis:

Biosynthetic assembly:

GlyTCHpgNMTTCAlaTCTrp

orf_5491

Domain Start End Score
Thioesterase 4 229 111.7

Detection: predicted by Prodigal
Start: 6252720 | End: 6253458 | Frame: +

Sequence: show MPLRAGGEGPALFCVPAAGGLGWSFAGLARHIPGRHPLYALQSPGLSDPRARNATVEETAARYVERIREVDPHGPYHLVGWSAGGLIAHEMAVRLRAAGAEVALLAALDAYPLADTPVTPPDPAEVRETVRGQADGHRLDDAAIDGLVAVYLGSTRAARAFTPGVFEGDLVHFAADRSATGTPAPRLWEPHIDGQVEQHRVACGHEEMTRPGPLAVIGPVLAGKLAREPAPPGGHPDEHRTHDA (hide)

Domain analysis:

Biosynthetic assembly:

TE