Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 20

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_5407 KSMalDH
orf_5408 TKSMalDH
orf_5409 KRTTE
orf_5410 ER
orf_5415 KSMeMT
orf_5416 KSMal
orf_5417 KRTKS
orf_5418 KS
orf_5419 T
orf_5423 TE
orf_5424 KSMeMDH
orf_5426 DHKR
orf_5427 KSMeM
orf_5428 KRT
orf_5430 Ala
orf_5431 T
orf_5432 Abu
orf_5433 HitC
orf_5434 IdnL3
orf_5435 IdnL4
orf_5436 VinJ
orf_5437 GTr
orf_5438 StrD
orf_5439 StrE
orf_5440 2,3DH
orf_5441 N,N-MT
orf_5442 GTr
orf_5443 CMT
orf_5445 GTr
orf_5446 3KR
orf_5447 4-AmT

Cluster:

    orf_5415orf_5416      orf_5427   orf_5432              

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 6
    (maximum 500)
  • Sugar combinations: 9 (maximum 100)
  • Subgraph combinations: 54
  • Total combinatorial plans: 1,000+ (maximum 1,000)
  • Scaffolds generated: 44 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Sugars:

9 possible sugar combinations identified.

Sugars Domains
4,6-dideoxy-4-hydroxylamino-D-glucose, 4-oxo-L-vancosamine, N,N-dimethyl-L-pyrrolosamine GTr4,6DH4-AmT4,6-dideoxy-4-hydroxylamino-D-glucoseGTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamine
4-oxo-L-vancosamine, Kedarosamine, N,N-dimethyl-L-pyrrolosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamine
4-oxo-L-vancosamine, N,N-dimethyl-L-pyrrolosamine, N,N-dimethyl-L-pyrrolosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamine
4,6-dideoxy-4-hydroxylamino-D-glucose, 4-oxo-L-vancosamine, Kedarosamine GTr4,6DH4-AmT4,6-dideoxy-4-hydroxylamino-D-glucoseGTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamine
4-oxo-L-vancosamine, Kedarosamine, Kedarosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamine
4-oxo-L-vancosamine, Kedarosamine, L-actinosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamineGTr4,6DH2,3DHL-actinosamine
4-oxo-L-vancosamine, 4-oxo-L-vancosamine, N,N-dimethyl-L-pyrrolosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamine
4-oxo-L-vancosamine, 4-oxo-L-vancosamine, Kedarosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DH3KR4-AmTN,N-MTKedarosamine
4-oxo-L-vancosamine, L-actinosamine, N,N-dimethyl-L-pyrrolosamine GTr4,6DH2,3DHE4-AmTCMT4-oxo-L-vancosamineGTr4,6DH2,3DHL-actinosamineGTr4,6DH2,3DH3KRE4-AmTN,N-MTN,N-dimethyl-L-pyrrolosamine
Show all 9Collapse

Analysis

orf_5407

Domain Start End Score
Ketosynthase+ 35 446 558.7
13_cremimycin_cis_Mal 588.0
7_vicenistatin_cis_MeM 585.0
8_cremimycin_cis_Mal 581.0
11_heronamide_cis_Mal 581.0
8_tirandamycin_cis_Mal 579.0
3_vicenistatin_cis_MeM 577.0
8_streptolydigin_cis_Mal 577.0
12_cremimycin_cis_Mal 577.0
9_AveA3-Q9S0R4-3mod_cis_ 576.0
4_AveA2-Q9S0R7-4mod_cis_ 574.0
Acyltransferase+ 558 851 341.3
Malonyl-CoA 3 269 560.0
Malonyl-CoA 3 269 354.2
Methylmalonyl-CoA 3 269 227.8
Methoxymalonyl-CoA 3 269 209.6
Ethylmalonyl-CoA 3 269 193.1
Methylmalonyl-CoA 3 269 189.7
Methylmalonyl-CoA 3 269 168.1
Methoxymalonyl-CoA 3 269 164.1
Methylmalonyl-CoA 3 269 161.6
Propionyl-CoA 3 269 95.7
Dehydratase+ 919 1082 254.8
Active dehydratase, cluster 3 2 163 215.3
Active dehydratase, cluster 2 2 163 212.6
Active dehydratase, cluster 8 2 163 210.3
Active dehydratase, cluster 6 2 163 209.4
Active dehydratase, cluster 4 2 163 206.5
Inactive dehydratase, cluster 2 2 163 205.5
Active dehydratase, cluster 19 2 163 190.0
Inactive dehydratase, cluster 6 2 163 186.9
Inactive dehydratase, cluster 5 2 163 157.3
Inactive dehydratase, cluster 1 134 163 1.5

Detection: predicted by Prodigal
Start: 6108403 | End: 6113263 | Frame: +

Sequence: show MSEDRLVGALRASLKETDRLREQNKRLMDAGREPIAIIGMACRFPGGVTTPEELWRLLAAGEDGIGRFPADRGWDLERLYDPTGERPGATYVREGGFLYGAGDFDADFFGISPRDALLMDPQQRLLLETAWEALERAGVPPHSVKGTPVGVFAGAMYHNYPGSYGSSGPLSGRLSYHLGIEGPAVTVDTACSSSLVTLHLAAQALRQGECPLALAGGVSVMSSPRTFVEFSIDGNLSRDGRCRPFAESADGTAWSEGAGMLLLERLSDARRNGHPVLAVVRGSAVNQDGASNGIAAPNGPAQQRVIRQALENARLSANQIDVVEAHGSSTEIGDPIEADALIATYGKDRPEDRPQWLGSVKSNLGHTQGAAGVAGVMKMVLAMRNELLPKTLYVDRPSRHIDWAEGAIKLLTEPVDWKANGSPRRAGVSSFGLSGTNAHVILEEAPPGPALPEDAAGTPESEATPVGPLPWMLSGRSRDALRAQAARLVEYLRDRPQDRPLDVACALATTRSPLDHRAVVTGTDRDELMSGLRAVADGEHAANVETGLARGESTTAFLFPGGGAQRLGMGRELAAVHPAFAAAYDEVCAELDQHLDRPLRPMIDGDAEALDQVGYAQAALFAIEVALFRLAESMGLRADFLAGHSTGELAAAHVAGILSLPDAARLVAARGRLMQGLPEGGAMVGINATEDEVRPLLTDGVGIAAVNSPDSVVVSGEAGEAHAVAELFAAKGVRTKRIRVSHAAHSPLMEPVLEEFRQVAAGLDFQQPRIPVVSTVTGELASGDDLRTPDYWVRHMRQTVRFRDAVEGLRAEGVTRFVELGPGGVLAAMAQECLTGTPDGSLLVVPLLRKGRSEELACATALAQLHVRGTSPDWKKWFEERGARPVELPTYAFQRQRYWLEASSAGGDPSSLGLEQADHPLLGAATVLADSEGLLLSGRLSLATHSWLRDHAVGGAVLLPGTAFVELAVHAGGRIGAPALRDLVLHAPLVLPEHGAVRVQVLAGPADASGTHPLSVYSRTEEGGDGTPWIQHASGTLERAGAVAPAALTVWPPEGAEPLDTDGMYEELAARGSGYGPMFQGRAAWRSGDEICAEVGLPENSRATAEDYGLHPAVFDAALHAIGLAATEDQGMALPYAWSGVELFATGASVVRVRVRPAAGDAPGRSVALDIADVTGQPVASVTTLTLREIAEEQLAAAVRPAAGTAGDALFGIEWTPAALPEPAEGLSIVDFASLAGADASAPAPDVVVLRVTGGSGADAARVATHRVLADVQTWLRDERCRASRLVVLTGGAVALPGEDVSDLGAAAVHGLIRSAQSEEPGRLLLVDGDAEPDALDLLPRIVGLNESSVAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRTARGARRDRRGALGGCARRRRVRLADARAPRQRAPSEGRRGVESARADQGDGADGLRAVLLRRRCARRARPGQLRRGQRVPRRPRPPPPLAGPARPLARVGTVGTVRGDGGGAQ (hide)

Domain analysis:

Biosynthetic assembly:

KSMalDH

orf_5408

Domain Start End Score
Thiolation 102 169 44.6
Ketosynthase+ 196 617 536.8
4_tirandamycin_cis_MeM 533.0
10_chlorothricin_cis_Mal 533.0
2_tirandamycin_cis_MeM 532.0
7_tautomycetin_cis_MeM 530.0
9_nanchangmycin_cis_Mal 526.0
9_dianemycin_cis_Mal 526.0
2_vicenistatin_cis_Mal 525.0
8_chlorothricin_cis_Mal 524.0
3_tirandamycin_cis_Mal 522.0
16_amphotericin_cis_Mal 522.0
Acyltransferase+ 736 1032 273.3
Malonyl-CoA 3 273 404.1
Malonyl-CoA 3 273 250.6
Methoxymalonyl-CoA 3 273 198.7
Methylmalonyl-CoA 3 267 154.0
Methylmalonyl-CoA 3 266 120.7
2-Methylbuteryl-CoA 3 268 99.4
Methoxymalonyl-CoA 3 260 97.5
Isobuteryl-CoA 54 271 96.1
Ethylmalonyl-CoA 3 267 82.0
Benzoyl-CoA 3 249 71.7
Dehydratase+ 1103 1158 81.9
Active dehydratase, cluster 3 2 55 66.7
Active dehydratase, cluster 8 2 55 65.7
Active dehydratase, cluster 19 2 55 65.6
Active dehydratase, cluster 2 2 55 65.5
Inactive dehydratase, cluster 2 2 55 64.7
Active dehydratase, cluster 4 2 55 64.6
Active dehydratase, cluster 6 2 55 62.9
Inactive dehydratase, cluster 6 2 55 59.3
Inactive dehydratase, cluster 3 2 55 47.2
Active dehydratase, cluster 20 2 55 12.2

Detection: predicted by Prodigal
Start: 6113243 | End: 6117857 | Frame: +

Sequence: show MAAVLSEPGAATSALRTGLPALSVAEGLELLDAATAAPGAVLVPLKLDIAALRERPDRVADVLRGVVPSVRRAASAPQAADGTVPGALAQLPPGERRAALLEVVLGSVMEVLGHSSTELIDTDRAFRDFGFDSLTAVELRNKLGGATGAQLASTVVFDYPTVAELAAHLHDTLFGRADADPEESRTQATAVDDDPIVIVSMACRYPGNVNTPEDLWQLVAEGRDATSPLPTDRSWDLDYWHSLLAGAGTVPRGGFVENATDFDAAFFGISPNEAIMMAPEQRMLMEICWEALESAGIDPLSLKESATGVFAGMMGGGGYDPGPLGELEQYSQYIGTGWHGSMISGRIAYVFGFEGPAISVDTACSSSLVALHLARQALRNGDCDLALAGGVTALSSLEPFAQYGGGIASDGRCKAYSASADGVGWGEGVGMVVLERLSDAQRNGHPVLAYVRGTAVNSDGASNGPTAPNGPSQERVIRKALDIAGLRPHEVDAVEGHGTGTTLGDPIEANALLATYGQDRPDDRPLWLGSVKTNMGHTQAAAGVAGVIKMVQAMLHGEVPMSRFADEPTPHVDWTTGNVKLLTETIPWPRTDRPRRAGVSSFGYSGTNAHAILEQGPGLRPEPETAPTPAPEDAVGTEPRTAPDGVLPWLLTARTAEALPAQAGRLLEHLAENPGLGADDIGYSLALRQPQFPYRAAVVGDTREEQLAALAALAAEEDSPRVVTGTAKSGARIAFLFPGHGTQRPGMGRELYAAFPAFAQALDEVCACFDPYLDRPLRDVMFSEPDSVNAQLLGQVAFGQAAQFALAVSLGRLLEFWKLSPDYLLGHSGGEIAAAHFAGVLTLHDAVKFTSNRTELIQDMPSGVMVGIEATEDEVRPTLTDGTDIAAVNGPRALVVSGEAEEARAVAEHWKGLGRRTKVLPIGAPGHSPLTETFLDDLRDVAEELTFSAPRTKIVSTVTGALTDGDALADPDHWVSNCRRAVRFMDGVRSLEAEGVTHYVDLGTEGALAAMASGCLTDAVDGAVVVPVQRKGTPEVTAAGLASGQLYADGSGVEPARIFAARGAAQVELPPYTFRRRRYWPDVDMAAVRASGGAPTGMEATGHPLLGAAVEVAESGELVLSGQISVDSQRWLADHAFGDTILFPGAGFAELAISAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGFRYGPAFRGLRAAWRRGDEVFSEVRLGPETGQSTERFGLHPAALDAALQTIALSEGIEVESGMPYSWSGIDLYATGATKLRVRVTPVRPDAAAVLLTDQAGQPVAAVETLVLRPVPDIGAVVATGHESLYGWDWVRLPAATRGPAAGAPVPLAVLGSDPGGLAAALGAAGFAATAHTGPGTLSAGPVPPVVVLDRSPSPTAQGPDAVHAGVRDTLACSQRCWTRRPSPAPRRCS (hide)

Domain analysis:

Biosynthetic assembly:

TKSMalDH

orf_5409

Domain Start End Score
Ketoreductase+ 106 283 166.9
Active ketoreductase, cluster 2 2 177 243.6
Inactive ketoreductase, cluster 1 2 177 235.2
Inactive ketoreductase, cluster 2 2 176 185.0
Active ketoreductase, cluster 1 35 177 154.5
Active ketoreductase, cluster 4 2 177 148.7
Active ketoreductase, cluster 6 2 177 124.0
Active ketoreductase, cluster 12 2 177 119.4
Active ketoreductase, cluster 3 36 177 103.6
Active ketoreductase, cluster 15 2 177 98.4
Active ketoreductase, cluster 27 41 89 0.8
Thiolation 386 453 44.5
Thioesterase 521 728 43.7

Detection: predicted by Prodigal
Start: 6117811 | End: 6120163 | Frame: +

Sequence: show MLDAEALAGTTAVLLTRGAVALPGEDVTDLVGAAVWGLLRSAQAENPGRFVLVDTDGSAASHEALHALLASGEPQAVVRAGTVHGGRLVRPPADGGEPGGTFGPEGTTLVTGATGAVGRVLTRHLVTAHGVRRLLLLSRGGEAPELVEELTGLGADVTLVACDAADRDALSAVLSAVPAEHPLTSVVHLAAVVDDGTLTSLTEEKLTAALRPKVDAAWNLHELTAESELTAFVLFSSVAGLLGNLGQANYAAANAYLDALAAHRRAAGLPAQSLAWGLWAATGSGGSGATPDEAQLAQEGMAALSDAEGAELFDAALARQEALLVPMKAGGRGAGTGGTEGVPHVFRSLVAPVRRAASRTTVSDTDALRRRLAGLTAEQLDKAMEELVLEHAGALLGYGDNETIDPERHFLESGFDSLTAVELRNGLNAATGLRLSATVAFDHQTPGGLARHMAAQIGAVPSTAGPADASGREPGSAGTGGEREPAPAAGESVPELFRAMVRAGQVQEGLGLLNWVVRTRSQFTSSADLERPPVSVRMADGDEAPHLVCLCTPAAMGGAYQYAKLVSAFKGARTVTVLPMPGFGPGEQLPASVPAALDVLAATVKDIVGDAPFALLGHSGGGLLAHATAGLLEEQGRPPLGVALLDTYLVEQTAGFQDFAAEVAVGALTREISYGQLGNATSLSAMAQYVALMPEIELKELATPTLLVKASERFATGPEDTAAATTADGPETAGDEAAADDWQTTWSLATRVETVPGDHFSLVEQGAETTAAVVENWLGTLA (hide)

Domain analysis:

Biosynthetic assembly:

KRTTE

orf_5410

Domain Start End Score
Enoylreductase 169 270 50.2

Detection: predicted by Prodigal
Start: 6120194 | End: 6121532 | Frame: +

Sequence: show MEALTEAVRAGAGPEELAGLPVPEEYLAAHTRVEDIGMFDGVEDKDVRKSLRVGKVPMPELAPDEVLVAVMASSVNYNTVWSGTFEPVPTFSFLKAYGKLGGWERRHDQPYHVLGSDAAGVIVRVGVGVRRWQVGDHVLASPIQVDDQEATTHADGMLGEGQKAWGYETNFGGLAHYCVVRASQLIPKPAHLTWEEAASTPACAGTAYRMLVSDRGARMKQGDVVLIWGAAGGLGAYAVQLVKHGGGIAVGVVGSEEKAQALRDLGCDLINRRELGIGDDDGSDPDKVIEAGKRLGRIIRREIGEDPNIVFEYVGRATFGISMFVVRRGGVVVTCGSSSGYQHQYDNRYLWMKLKRIVGSHAANLSEQWESNRLIEMGRIMPILSTVYRLEDIGDAARLVQTNGHMGKIGVLCLASERGLGVTDRAKRDAIGERRLNPLGDGRA (hide)

Domain analysis:

Biosynthetic assembly:

ER

orf_5415

Domain Start End Score
Ketosynthase+ 36 447 564.7
7_vicenistatin_cis_MeM 607.0
7_tetramycin_cis_Mal 598.0
7_pladienolide_cis_MeM 590.0
8_streptolydigin_cis_Mal 590.0
2_vicenistatin_cis_Mal 589.0
8_tirandamycin_cis_Mal 589.0
7_natamycin_cis_Mal 588.0
8_cremimycin_cis_Mal 588.0
4_pladienolide_cis_MeM 587.0
3_4-Z-annimycin_cis_MeM 587.0
Acyltransferase+ 556 857 334.0
Methylmalonyl-CoA 3 278 535.2
Methylmalonyl-CoA 3 278 506.9
Methylmalonyl-CoA 3 278 493.8
Methoxymalonyl-CoA 3 278 464.2
Methylmalonyl-CoA 3 278 458.4
Ethylmalonyl-CoA 3 278 435.3
Ethylmalonyl-CoA 3 278 402.0
Ethylmalonyl-CoA 3 278 391.8
2-Methylbuteryl-CoA 3 278 302.3
Malonyl-CoA 3 278 137.0
Thiolation 1490 1557 38.5

Detection: predicted by Prodigal
Start: 6124564 | End: 6129499 | Frame: +

Sequence: show MANEDKLRAYLKRATADLQQAKAQLREVEERGREPIAIVGMSCRYPGGVSTPEDLWELVAEGRDAIGDFPADRGWDLDGIYHPEPEQPGKSYVRNGGFLYDAAEFDAAFFGISPRDARGTDPQQRLLLEASWEAVERAGMAPESLRGSLTGVFAGVMYHDYDAGAPGGSLVSGQVAYNLGLEGPAVSVDTACSSSLVAVHLAAQALRRGDCTLALAGGVAVMSTPEIFVDFSRRRGLAPDGRCKPFSDDADGTSWAEGVGVLVLERLSDARRLGHRVLGVVRGSAVNQDGASNGMTAPNGPAQVKVIKRALDDAGLLPSDIDAVEAHGTGTTLGDPIEAQALLATYGAARDAGQPLWLGSVKSNIGHPQAAAGIAGIAKLLLAMEHGQLPPTLHVSEPTRHVDWSSGTVRLLTGPVDWKPAGRPRRAAVSAFGLSGTNAHIVLEEPPADTGQDAPADPVPRPGSVPLVLSGRTEDALRAWARRLAGRTGAAEAGHPADIGHSLVASRSAFEHRAVVIGDAADPAGLTDALRSLARGRSEADVVTGRADLHGKTVFVFPGQGSKWAGMATELLDRSEVFAHRLAACERALSAFTDWRVTDVLRGAEGAPPADRVDVVQSTLWAVMVSLAAVWRAHGVEPDVVIGHSQGEIAAACVAGALSLDDGARVVALRSRAIAEDLDSRGGMMAVGLPAERAAERAAERAARWDGRISVAADNGAASSVLSGDAEALDALGEELRGEGVRAKRVPVNYASHSPHVDALRERLLRDLEPVAPREGEVPMLSTVTGTWVTGPELDAAYWFDNLRHRVRFAPVVGTLATSGHTAFVEVSPHPVLTMSIQETVEDLDAAAVVTGTLRRDEGGPRRFLRSLAEQYVRGTGCDWTVCYPDARLVDVPTYPFQRSHYWERPEAGPDTAPAPGAAADESGFWADVERHDAEALAARLDVGAERLRDILPALSAWRRDRLTDAAVDAWRYRVSWSPLPGGPFAGLTGTWLLVTPPDAPRAKAAAEALTVHGATVVTVETDRADRAELADRLRAPECRDAAGVLSLLADGTPGHADGPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDESHLVVADIDWETFVPVYTLTRARPLLRELPEARRASEERNGDDPEPDGRTDDGGLAESLAGLTEPEQRRRLLDLVRTHVAVVLGHDSTSAVEPARAFKEVGFDSVTAVDLRNRLGSACGVRLPATVVFDHVSPQALAGHWTLLCQGEGGALAGRPLTVELDRLEARIAGLTRDEVERTRVTTRLQALVAKLTETLAGGQGTAARDRLETATADDLFDLIDNELGAA (hide)

Domain analysis:

Biosynthetic assembly:

KSMeMT

orf_5416

Domain Start End Score
Ketosynthase+ 36 462 566.2
11_cremimycin_cis_MeM 595.0
4_AveA2-Q9S0R7-4mod_cis_ 588.0
7_gledanamycin_cis_MeM 588.0
4_vicenistatin_cis_Mal 585.0
4_tirandamycin_cis_MeM 581.0
2_tirandamycin_cis_MeM 576.0
2_vicenistatin_cis_Mal 575.0
5_pladienolide_cis_Mal 575.0
8_tirandamycin_cis_Mal 574.0
14_meridamycin_cis_MeM 573.0
Acyltransferase+ 594 887 366.5
Malonyl-CoA 3 270 643.0
Malonyl-CoA 3 270 408.8
Methoxymalonyl-CoA 3 270 256.6
Methylmalonyl-CoA 3 266 242.3
Methylmalonyl-CoA 4 266 174.7
Methoxymalonyl-CoA 4 267 166.9
Ethylmalonyl-CoA 4 267 162.8
Methylmalonyl-CoA 4 267 161.5
2-Methylbuteryl-CoA 3 269 153.5
Propionyl-CoA 3 268 117.3

Detection: predicted by Prodigal
Start: 6129626 | End: 6134009 | Frame: +

Sequence: show MANEEKLVDYLKRVTATLQETRERLRERESAEREPIAIVSMGCRYPGDVRTPEDLWRLVADGADAIGPFPGDRDWDRVAFETDPDDPDARRVTEGGFLAGAGDFDAAFFGISPREALALDPQQRIALELAWETVERAGIAPHSLQQKPVGVFLGSGSQDYYDGVAPARMAEVADDYLSTGTASSVISGRIAYALGLEGPAVTVDTACSSSLVALHLAAQALRNLDCSLALAGGVMVMATPSPFQAFSKQRGLAPDGRCKAFSDDADGTGWSEGAGLLLLERLSDARRNGHPVLAVIRGSAINSDGASNGLTAPNGLSQQRVIRQALTNAGLSPADIDAVEGHGTGTTLGDPIEAQALLATYGADRPRERPLWLGSVKSNIGHAQAAAGVSGVIKMVHALRHGLLPKTLHVSKPTEEVDWTTGGVRLLQEPREWGRGDGPRRAGVSSFGVSGTNAHVILEEHVILEEAEATPAPHTAHDAPEDAPADQGTTLPDAPLPDAPSWPAGLPVPLPLSGLTPDALRAQVARLVPVADSGASALDLGFSLATTRSPLQQRAVVLAEDAESAARALGALADGSTPPGTHLGAVQHGQTAFLFSGQGSQRAGMGRELYGRFPVFAQALDEVCAAFDSHGHGRALRDVIFDEPELLDRTGWAQPALFAVEVALFRLLGSWGVTPDLLFGHSIGELVAAHVAGVLSLQDACVLVAARGRLMEALPEGGAMAAVEATEGEVRPLLNDRVDLAAVNGPSSVVVSGDADAVLAVTAHFDSEGRRTKRLRVSHAFHSVHMDAMLEEFEAVARGLTYAPPAVPIVSDVTGQPATAEELCDPAYWVRHVRRAVRFHDGVRSLEAAGATRFVEIGPDGTLTATVRACLTTAGDTAVAVPLLRRRPEPEALLGALARLHVSGVDPDWAAVFAGRGARRIPLPTYPFQHRRYWLDGAYPAGRPGASGRGCAPFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAARTAGARS (hide)

Domain analysis:

Biosynthetic assembly:

KSMal

orf_5417

Domain Start End Score
Ketoreductase+ 3 119 144.1
Active ketoreductase, cluster 2 1 116 179.3
Inactive ketoreductase, cluster 1 1 116 174.8
Active ketoreductase, cluster 1 1 116 147.2
Active ketoreductase, cluster 4 1 116 136.4
Inactive ketoreductase, cluster 2 1 116 126.0
Active ketoreductase, cluster 12 1 116 113.9
Active ketoreductase, cluster 6 1 116 109.0
Active ketoreductase, cluster 3 1 116 93.9
Inactive ketoreductase, cluster 4 2 116 86.1
Active ketoreductase, cluster 5 1 63 11.4
Thiolation 227 293 48.6
Ketosynthase+ 320 526 240.2
11_heronamide_cis_Mal 297.0
4_tiacumicin_cis_EtM 296.0
12_cremimycin_cis_Mal 294.0
7_heronamide_cis_Mal 293.0
7_vicenistatin_cis_MeM 291.0
5_salinomycin_cis_Mal 291.0
2_TylGIII-O33956-1mod_cis_ 287.0
12_heronamide_cis_Mal 286.0
8_cremimycin_cis_Mal 286.0
16_amphotericin_cis_Mal 285.0

Detection: predicted by Prodigal
Start: 6134176 | End: 6136195 | Frame: +

Sequence: show MTDRAALADALAQVPEGHPLTAVVHAAGVLDDGLVTSLTPDRVDAVLRPKVEGALHLHELTEGMDLAAFVLFSSVSGVLGSPGQANYAAANAFLDALAAHRAALGLPAKSLAWGLWGQVAGMGGKLAGADMSRHARGGLLPLTTEQGLALFDASLGTATAADVAVRLDLDALRTSPAQTHPALRGLVGGGARRSAAGATGQDGTATTFAERLAALPEGERHTTVAGLVRAHTAAVLDYASAEEIDADLEFHRFGFDSLTAIELRNALDSATGLRLPATLIFDHPTPAALAAHLLDELTGTGTGAATAAPTAVRAVDDDPIALVGLACRLPGGVASPEDLWRLLTEEGSGIGDFPADRGWDIDGLYDPKGGRPGSSYVREGGFLYDAGDFDPGFFGIAPKEAPMIDPQQRLLLEASWEALERSGIDPRSLKGSRTGVYVGVQYHDYAGAASSGSMVTGRVAYTLGLAGPAVSVDTACSSSLVALHLAARALRAGECSLALAGGAAVMATPDSFVEFSRQQGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAAARHPGGAGRRRADPGRRRRGRGPRHRDQTRRPDRGAGTAGDLRAGPAGGPAAARRLREVQHRAHPGRRRRRGRHQDGDGPAPR (hide)

Domain analysis:

Biosynthetic assembly:

KRTKS

orf_5418

Domain Start End Score
Ketosynthase+ 1 68 68.3
6_tautomycetin_cis_MeM 111.0
2_tautomycetin_cis_MeM 110.0
12_tautomycin_cis_Mal 108.0
12_reveromycin_cis_MeM 108.0
8_tautomycetin_cis_Mal 108.0
5_tautomycin_cis_MeM 108.0
5_tautomycetin_cis_Mal 108.0
6_tautomycin_cis_MeM 107.0
7_tautomycin_cis_Mal 107.0
4_tautomycin_cis_Mal 107.0

Detection: predicted by Prodigal
Start: 6136169 | End: 6137024 | Frame: +

Sequence: show MVMALRHGELPKTLHVSEPSTEVDWSAGNVRLLTESRPWQPGGRPRRAGISSFGVSGTNAHLIIEEPQEARVPAADEPEPSDAGPPAVPWLLSGRNRAALAARAEQLLSYLDEDPDRDLADIGYSLATSRAALECRAVVVGRRHPEFLRGLMALVDGEEAPGVAEGLARGRGRLGFLFSGQGSQWAGMGRELHHAHPAFAAALDDVCAALDARLDRPLREVMWAKTGQNRRRSSWTAPGYNPAGPLRRGRRQKSGCWSPGGSPPTPSPGTPSASWPPRTSPGC (hide)

Domain analysis:

Biosynthetic assembly:

KS

orf_5419

Domain Start End Score
Thiolation 56 123 46.5

Detection: predicted by Prodigal
Start: 6139850 | End: 6140591 | Frame: +

Sequence: show MDTDALADTEELPPLFRGLVRAPARRTAQEAQPETGTLRERLAGMPEHQRMPALLKLVRTHAAGILGYSGAEEIDLDRPFNEAGFDSLSAMGFRNKLTLVTGLKLPAGMIFDYPNPRALAAHGEELAPEPDPGSADRGGAGAFAEHEVRELLASIPVARLREAGLLASLLELADAGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRREGHGAEREGGTPSIDTMDSEALINMAIGGAGD (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_5423

Domain Start End Score
Thioesterase 3 237 61.8

Detection: predicted by Prodigal
Start: 6143361 | End: 6144138 | Frame: -

Sequence: show MTSASGEPSAWIRRFHAAPSAPTRLVCLPHAGGSASYFFPVATALTPGVEVLAVQYPGRQDRRTETCIDDLHELADHVARELKLWADRPVTLFGHSMGAVLAYEVARRLRGSDVELLGVLASGRGAPSRARVHDVHLMRDDMLLREVRALSGTEDKLFEDDEIVRMVLPALRSDYKAVETYRHDPDDKLSCPVVALLGDDDPRVSEDEARAWEDHTDGEFGMRVFPGGHFYLNDQAGVLSVVTEHIAKWSAATGRAG (hide)

Domain analysis:

Biosynthetic assembly:

TE

orf_5424

Domain Start End Score
Ketosynthase+ 43 469 606.9
3_vicenistatin_cis_MeM 671.0
2_vicenistatin_cis_Mal 655.0
6_indanomycin_cis_Mal 647.0
8_tirandamycin_cis_Mal 643.0
8_vicenistatin_cis_MeM 639.0
5_streptazone_cis_Mal 638.0
7_cremimycin_cis_Mal 637.0
6_bafilomycin_cis_Mal 635.0
9_meridamycin_cis_Mal 635.0
9_pladienolide_cis_MeM 634.0
Acyltransferase+ 595 901 306.9
Methylmalonyl-CoA 3 283 460.3
Methylmalonyl-CoA 3 283 459.7
Methylmalonyl-CoA 3 283 429.6
Methoxymalonyl-CoA 3 283 381.8
Ethylmalonyl-CoA 3 283 373.1
Methylmalonyl-CoA 3 283 348.6
Ethylmalonyl-CoA 3 283 305.9
Ethylmalonyl-CoA 64 283 286.6
Methoxymalonyl-CoA 3 283 253.2
Malonyl-CoA 74 283 103.9
Dehydratase+ 969 1131 245.7
Active dehydratase, cluster 6 2 162 210.7
Active dehydratase, cluster 3 2 162 209.5
Active dehydratase, cluster 2 2 162 207.1
Active dehydratase, cluster 8 2 162 206.6
Inactive dehydratase, cluster 2 2 162 206.3
Active dehydratase, cluster 4 2 162 203.5
Active dehydratase, cluster 19 2 162 196.5
Inactive dehydratase, cluster 6 2 162 184.5
Inactive dehydratase, cluster 5 2 162 167.6
Active dehydratase, cluster 10 127 162 2.1

Detection: predicted by Prodigal
Start: 6144512 | End: 6148211 | Frame: +

Sequence: show MTSVGNSVGNEEKLLNYLKRATADLREARRKLSEVEAQQHAPVAIVGMACRYPGGVRSPEDLWQLVSEGVDGISAFPQDRDWDVEGLYDPEPGKPGKSYVREGGFLYDAADFDPAFFGISPREALAMDPQQRLLLEVSWEAFERAGIDLTSVRGTPTGVFAGVMYHDYGSWVRDIPEELAGYLGNGTAGSILSGRVAYTLGLEGPAMTIDTACSSSLVALHSATRALRSGECSLALAGGVTVMSTPDTFVEFSLQRGLAADGRCKAFSSDADGTAWGEGAAMLLLERLDDAHRNGHQVLGVIRGSAVNQDGASSGMTAPSGPSQQRVIRAALEDAGLSAAEVDAVEAHGTGTKLGDPIEAQALLATYGADRPAEQPLWLGSVKSNIGHTQAAAGVAGVIKMVQAMRHGVLPQTLHVDAPSTHVDWTAGAVELLTESLPWETPDGRPRRAGVSSFGLSGTNAHVIVEQEPVSAGAGAVDESAGDADGGRDGAAEGVGGGDATPERGTWDALAWPVSAATDGALRDQAAALLRLAEDADVDPADIGHSLVRGRTALGRRAVVTGRDREELRAELARLAAGESPTRKVSTAGGRLAFVFPGQGTQWVGMGARLVRESAVFAERMGECARVLEPLVDWSLWKVLAEADEEGVGAGVGGGVGGSLLGRVDVVQPVSFAVMVSLAALWGSLGVVPDAVVGHSQGEIAAAVVSGALSLEDGAWVVVLRSRVIAGSLVGGGGMLSVGLSVGELVGRLPVGVSVAAVNGPSSVVVSGDVEGLGVLEGVLVGEGVRVRRVAVDYASHSVQVGLVEEELLRVLAPVVGRVPEVPFFSSVLGGWVGGGVVDGGYWYRNLREPVLFADAVGVLVGEGFSVFVEVSAHPVLVPGVSELLDVAGVEGVVVGSLRRGDGGLDRFLRSVGELWASGVGVDWGAVVPVGAGRVDLPTYSFQRQRYWLDGSAGNTTDPAALGLTPTGHPLLGAAVTLAEGGALAFTGRVDLRTHPWLAEHAVTGHVLFPGTGFVDLAVRVADETGSGAVEELTLTAPLVLPTTGGVDLQIMVGPAENHHRPFAVYSRPVGALPDTPWTQHATGLLGEPARSGDFSLAQWPPPGARPVDVRDAYEHLAERGYDYGPTFQGRAVWRAGTVVCAEVALPDETDASRSVSTPRCSTPHCTPSTTANSPAPYEKVRSPSPSRGTASRCSPRARPRSAYGCHPRGRTPWPSRWPTRPEHRSRRSSR (hide)

Domain analysis:

Biosynthetic assembly:

KSMeMDH

orf_5426

Domain Start End Score
Dehydratase+ 11 186 233.0
Active dehydratase, cluster 8 2 175 210.7
Active dehydratase, cluster 6 2 175 208.2
Active dehydratase, cluster 3 2 175 207.8
Active dehydratase, cluster 2 2 175 205.6
Active dehydratase, cluster 4 2 175 205.2
Inactive dehydratase, cluster 2 2 175 200.6
Active dehydratase, cluster 19 2 175 199.7
Inactive dehydratase, cluster 6 2 175 168.1
Inactive dehydratase, cluster 5 2 175 142.1
Active dehydratase, cluster 75 137 175 1.7
Ketoreductase+ 478 654 178.4
Active ketoreductase, cluster 2 2 176 244.6
Inactive ketoreductase, cluster 1 2 176 222.5
Inactive ketoreductase, cluster 2 2 176 167.6
Active ketoreductase, cluster 4 2 176 158.4
Active ketoreductase, cluster 6 2 176 135.4
Active ketoreductase, cluster 1 36 176 133.7
Inactive ketoreductase, cluster 6 3 176 130.0
Active ketoreductase, cluster 12 2 176 126.2
Inactive ketoreductase, cluster 5 2 173 97.4
Active ketoreductase, cluster 7 3 41 10.6

Detection: predicted by Prodigal
Start: 6152763 | End: 6155421 | Frame: +

Sequence: show MGVSGQVGAGHPLLAAVLDHVDGGGVTLTGRLSLATHPWLADHAVHGAVLVPGTALVEMVLRAGQETGTPTIDELMLEAPLVLPERDAVDVRVDVGEAEENGRRPVRVHSRDGEGEWLRHATGYLTPEAPEAPEAPEAPEASDGTTDGAAHLEVWPPAGAEQLDVAGAYDELADRGYAYGTAFQGLLAAWRRGAETYAEVALPAQTAQAAESDARTFGIHPALLDACWHALLLGDPEGSPMIPFAWTGVALQAEGVSHVRVRIAPAGPDTTAMTVADQAGKPVASVAGLVARPVSAQQLSAAPRSLYRVTQTALPGAVGGIGDTDGWAVLGADVHDLGHRVYAEPGVVPDPVPRFVTYDCPAIDGTVPEAVRTATCDLLVLLAGWLEEPRFAEAHLVLTVGEHLTQAPLAGLVRAAQAEHPGRITLVRTTGSPVNAGLLADAAATGEPELAIADGEIHAPRLTRITDLEPSGESALLGPVLITGGTGGLGALVARHLAVRHGIREFVLLSRRGPQAPEAGRIQEELAQLGATAAIVACDAADRAELAEVLERHPVRSVVHAAGVVDNAVLTSLTPERVAAVLRPKVDAAWNLHELTAGHDLAAFVLFSSSAGILLGAGQSNYATANVFLDELAAYRRANGLPALSLAWGLWDESGMAGGLDEMGRQRMRRLGMPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQRGRGRGEPRVPRVRLRLPDRGGTAEPAQLRHGAAASRDSRLRLPDPRDPRRLSERRTVRHECLFRRHGGCCGRGGCCGWCCGWC (hide)

Domain analysis:

Biosynthetic assembly:

DHKR

orf_5427

Domain Start End Score
Ketosynthase+ 50 384 454.6
2_elaiophylin_cis_EtM 500.0
2_4-Z-annimycin_cis_Mal 496.0
2_streptolydigin_cis_MeM 484.0
2_ebelactone_cis_MeM 477.0
7_AveA3-Q9S0R4-2mod_cis_ 474.0
2_pladienolide_cis_MeM 474.0
6_cremimycin_cis_Mal 474.0
2_tirandamycin_cis_MeM 473.0
5_coelimycin_cis_MaI 473.0
8_pladienolide_cis_Mal 473.0
Acyltransferase+ 499 769 277.0
Methylmalonyl-CoA 3 262 437.0
Methylmalonyl-CoA 3 264 434.1
Methylmalonyl-CoA 3 264 403.4
Methoxymalonyl-CoA 3 263 368.2
Ethylmalonyl-CoA 3 263 350.9
Methylmalonyl-CoA 3 265 332.2
Ethylmalonyl-CoA 3 263 285.5
Ethylmalonyl-CoA 3 262 283.9
Methoxymalonyl-CoA 3 262 238.9
Malonyl-CoA 3 264 98.3

Detection: predicted by Prodigal
Start: 6157093 | End: 6161209 | Frame: +

Sequence: show MFAEAFDEVIGLVGEGVREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEAFERAGIDPATLHGGRTGVFVGAEQQEYGPRLDEAAAGVDGYLVTGNALSVAAGRLSYNYGLNGPAYAVDTACSSSLVALHLAVRSLRAGECSLALAGGAAVLSRPGTYTAFSRQRALAPDGKCKAFAAAADGTQFSEGVGLIVLERLSDARRNGHQVLAVLRGSAVNQDGASNGLTAPSGIAQQQVIRDALADAGLSAAEVDAVEAHGTGTTLGDPIEAHALLATYGQDREDAEALRLGSLKSNIGHTQAAAGVAGVIKMVQAMRHGVLPQTLHVDAPSDQVDWSAGAVELLTESLPWETPDGRPRRAGISSFGVSGTNAHLIVEQAPVEPSAEDERSDGRDDDQADTAATAVVPAVPWMLSAKSQDALRDQAARLLAHVESHTAGRPVDVAYSLAATRAPLPHRAVFVGSDEAELRAELSAFANGTGVSPQPSTAGGRLAFVFPGQGTQWVGMGARLVRESAVFAERMGECARVLEPLVDWSLWEVLAEADEEGVGGGVGGSLLGRVDVVQPVSFAVMVSLAALWGSLGVVPDAVVGHSQGEIAAAVVSGALSLEDGAWVVVLRSRVIAGSLVGGGGMLSVGLSVGDVVGRLPVGVSVAAVNGPSSVVVSGDVEGLGVLEGVLVGEGVRVRRVAVDYASHSVQVGLVEEELLRVLAPVVGRVPEVPFFSSVLGGWVGGGVVDGGYWYRNLREPVLFADAVGVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGLRRGRAPGGRGRERLRHASRTAGRGVARWGVVRRERRGHHAVRLARCHPARDGSHRAAGQADPGR (hide)

Domain analysis:

Biosynthetic assembly:

KSMeM

orf_5428

Domain Start End Score
Ketoreductase+ 318 423 131.0
Active ketoreductase, cluster 2 1 105 150.9
Inactive ketoreductase, cluster 1 1 105 144.9
Active ketoreductase, cluster 4 1 105 118.3
Active ketoreductase, cluster 1 1 105 113.8
Inactive ketoreductase, cluster 2 1 105 106.1
Active ketoreductase, cluster 12 1 105 99.8
Active ketoreductase, cluster 6 1 105 79.3
Active ketoreductase, cluster 3 3 105 71.7
Inactive ketoreductase, cluster 4 1 105 70.1
Active ketoreductase, cluster 5 2 50 1.6
Thiolation 530 597 44.5

Detection: predicted by Prodigal
Start: 6161177 | End: 6163238 | Frame: +

Sequence: show MLRVRLTRAGEGAGYAITATDPGGGLVLTVDSFVPRAVSADEIADEFGGEFGGDLVHDDLFTLDWTAVGPPSGAAEAEATAEKGGTTVWAVLGAARPSPSLPGAVSYEVLAALLASTGPMPDAVLHVPQVPAGDPPAAVRKTVADTLALLNDWLSAERCAAARLVVATTGSGPVDGAVAGLVRAAQAENPDRITLVHLGPDEIRADLLTQGLRSGEPEFAIHDGEVRVARLTRATGAVKSPEPGASVLVTGGTGGLGAAVACHLAARYRVSELVLVSRRGTEAPGARELVAELSGHGVRATVVACDVGDREAVARLLADHPVSGIVHTAGVLDDGLIGSLTPERFDPVFRSKADAAWHLHELAEEMSLDLSMFVMFSSAAGTFDGAGQANYAAANGFLDALAAHRHRLGLPATSLAWGLWEERSGMAGALGEADLERMHRSGMRALPTAHGLALFDTAVGLELPVVLPMRLDTAAVGERGRDVPAVLRGLVRSAVPQRRSADSAPAEPEMPFEERLAAMRPRERAPFLLDLVRTQVAVVLGHDGPRDIDPKRGFTDFGVDSLAALELRNLLAKLTDVRLPATLVFDHPTPQAVADLFEELVDDPDSGLPLGAEFAAIEEALRTADPADEQYASVITRLRALTEAWTGPRTEQARARAADEEEIGSATAEELFGILDGELGELGEE (hide)

Domain analysis:

Biosynthetic assembly:

KRT

orf_5430

Domain Start End Score
Adenylation+ 13 419 234.9
Alanine 1 406 662.1
Proline 3 406 229.1
2,3-diaminopropionate 9 406 216.2
Alanine 23 406 204.9
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 6 406 174.0
Alanine 5 406 170.8
Beta-hydroxytyrosine biosynthesis 3 406 166.9
Histidine 16 406 163.1
Valine 9 406 157.9
Glutamate 7 406 108.7

Detection: predicted by Prodigal
Start: 6164633 | End: 6166274 | Frame: -

Sequence: show MAESAEYALHSRFLRGLAASPDGIAARAGKESRSYAEMHDLALRWGGSLARTGSPAVGVLAARGLTAYTGILAALYAGAAVVPLRPDFPASRTRQIIEASGLRTVVADDAGLAVLPEVLDGIGEMSVLAPDAADGATVPGVRLLPAHAAALDEPAPVKPDDPAYYLFTSGSTGRPKGVALTHGGTEHYFRLADERYDFGPGDVFSQAFELNFDCGAFDLFCAWGAGATVVTIPPGAYLDLPSFVAQQGLTVWFSTPSAIDLVRRVGGLGANVLAGLRWSLFAGEALKCRDAEDWQHSAPASVLENLYGPTELTITIAAHRWSSEHSPAAAVNGLSPIGPVHRGHLHLLLDDDGEPCENEGELCVSGPQLASGYLDPGDEEGRFFERDGRRWYRTGDRVRRLDGDELVYLGRRDAQVQIGWRVELAEVEHALRLCDVADAVAVAVMGATGTELAAFYTGDPVPTAGLVGRLRAHLPAGVLPKHYHHLPEFPLNANKKVDRLRLAAYAQDLIDGADGGTDFCGTSTSSTSSTSGTADEPATGAGEPR (hide)

Domain analysis:

Biosynthetic assembly:

Ala

orf_5431

Domain Start End Score
Thiolation 5 74 29.9

Detection: predicted by Prodigal
Start: 6166415 | End: 6166655 | Frame: +

Sequence: show MWDTRFEELLRGHLPYLGATEPLGADLSLRDAGLDSMAMVELLSSIESSYDVRFADEAMSMRNFETPARLWATESVRA (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_5432

Domain Start End Score
Adenylation+ 22 431 268.2
3-amino-butyric acid 1 409 804.8
3-aminonon-5-enoic acid 1 409 606.5
β-phenylalanine 1 409 582.1
3-aminonon-5-enoic acid 1 409 542.9
Proline 2 409 232.9
Histidine 17 409 184.1
Piperazic acid 7 409 167.0
Modified tyrosine 5 409 166.2
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 6 409 165.2
β-hydroxy-asparagine 3 409 109.7

Detection: predicted by Prodigal
Start: 6166738 | End: 6168415 | Frame: +

Sequence: show MGREIFMRGQNASERLHEFLLLGAQLTPEKPAVVEYHENETGLLSYRQLQDRVTGYAKTLDELGLDMGDRVILEADTSASSIAAFLACSSRGLPFIPISPETPTKRLLSILDTIRPAFYLQADDGRRDGIPEHIGTGRFGGSGVTIERAAAPRVRHRREIVAADPAYVVFTSGTTGRPKGVVMSHRGILAFYRGMLQHGIVGPESRVATTAPLQFDFSLLDIGLALGTGATIAPVPRSLLRWPRRFVKFLRDAEITQVNGSPSIWRPVLRHESAQLAELGDRIRGVLYSGESFPLPEMRQLQELLPEARIVNCYGSTESIAASFTDVPRPLPKDMERMSIGYAHPGAEMMLVDDDGAPVTEQGADGHILLRSSALFTAYWDDPAATGEALVPDPAAPESGQVVFRTGDVATRGEGGELYLVGRADSMVKIGNRVELGEVERRAAEFAGVAAASAVLMPRSGADPVLAVFVVLTPEARKDGTFDEMGLCAFCMGDLPGYMAPQEIHVVDELPVTPNGKIDRPALREIGEAAAAARRDTAVTGAPAGAAAPTADRSDRP (hide)

Domain analysis:

Biosynthetic assembly:

Abu

orf_5433

Domain Start End Score
Protected amine ACP acyltransferase (non-decarboxymethylaspartate-Ala 17 329 510.0

Detection: predicted by Prodigal
Start: 6168356 | End: 6169346 | Frame: -

Sequence: show MKNTSQHADDVPDARDADGIPGGGTAIVFPGMGPQDFAVSGKFLLIDPVASRLLAEASDTVGYDVFAHYRDSASDYSEEAQIAFLVVCLALARRAETTRGLSPRLCVGPSFGGKGAAVYSGALSFGDAVRLTSQLARYEAAFFAEECPGIVTHSFARTPRAVLDAIGAELTAAGEWHEISCHIDDDFFMLSLREERLEWLQKMLRAEGGMPLYTMNPPMHASLFAPLRDRVEAELFADLSFADPRIPVVADQDGSVVTTADGVRTMLLDGFVRPVSWPAVVDTLLRSGVRDLCVAGPDSLFSRVPRTTRNFTVDQIGPQSVLRPRPAR (hide)

Domain analysis:

Biosynthetic assembly:

HitC

orf_5434

Domain Start End Score
&;beta-glutamate decarboxylase 46 463 793.8

Detection: predicted by Prodigal
Start: 6169436 | End: 6170831 | Frame: -

Sequence: show MTAHAHARTDAGPDAGTDPAAVAPGGGPTAGAPGGGPRAGAPGGARTARRISPNLALDQLVAERQARGERITHLGFGESRLPVFPPLAERLAAGASRNAYGPVAGDPGVRAAVAGYFARRGLETDPAQVIVAPGSKALLLALQLVEPGDVFLPAPCWVTYQPQATLAGKRAFGVPVPAHCGGVPEPGALRTAVRAARAAGHHPRLVVLTLPDNPTGTLAPPGTVREVCAVAEEEDLLVVSDEIYRDILHASAPPFLSPAEVVPERTIVVTGLSKSLALGGWRIGVARFPAGPAGERLCADVASVASEVWSTLAGPMQAVAEYAFAEPPELLERLRRDAHLHGAVAGAVHDIVIAAGAECRPPTGGFYVYPDFGPVRDRLAGEGIVDGESLQRHLIEESGIAVLAGVHFGDAPDALRFRAATSMLYGRTRDEQRAAQEAEKPLELPHITDSLSAIRRGFTALTG (hide)

Domain analysis:

Biosynthetic assembly:

IdnL3

orf_5435

Domain Start End Score
Glutamate 2,3-aminomutase 1 448 902.1

Detection: predicted by Prodigal
Start: 6170851 | End: 6172198 | Frame: -

Sequence: show MPAQRPTAGEVTRFRTVGPQHMDEVAARYGMSHSALETVRAVSRVLPFRVNDYVLSELIDWHRVPEDPIFQLVFPQHGMLRAEDEKLLVDLARARAPKREIAAEVRRIRAGLNPHPSGQMELNVPSLADDALEGIQHKYRETVLYFPQQGQTCHSYCTYCFRWAQFIGDADLRFAAPGPERLVEYLRCHPAVSDVLFTGGDPMVMSTERLRSHLEPVLSVETVRTVRIGTKAVAYWPQRFVSDADADDLLRLFEQVVASGRTLAVMAHFSHPRELETATARRALGRVRATGAVVYCQAPLIAHVNDDARTWAELWRAELSAGTVPYYMFVERDTGPRHYFEVPLTKGLEIFRTAYSKLPGLARTVRGPVMSATPGKVLVDGVEETAEGRFFQLRMVQARDPDLVGRPFRARWSPTAAWMDQLELDPSAPADIAAAFAGSRRPLAGVT (hide)

Domain analysis:

Biosynthetic assembly:

IdnL4

orf_5436

Domain Start End Score
Amine-deprotecting peptidase 1 300 564.3

Detection: predicted by Prodigal
Start: 6172232 | End: 6173150 | Frame: -

Sequence: show MAVAAGAKGRIPFREYRTWYRLTGTPGRGRPAVVVVHGGPGSTHDYLIGLSSLSEDGWPVVHYDQLGNGGSTHLPDAGADFWTVGLFLEELDNLLRHLGVADDYVLVGQSWGGMLAARHAADRPGGLRGLVIANSPASYPLWRQEMEALRAALPPGVDATLRAHEVAGTTHTEEYAEAVKVFNDRHVCRVRPLPPAYVASVMETANDPTVYHTMNGPSEFHVVGTLKDWSVEDRLPDIAVPTLVLSGRHDEATPATVRPFLERISDVRWEILEESSHMPHLEEPELFHATLVDFLKSLDRRSDG (hide)

Domain analysis:

Biosynthetic assembly:

VinJ

orf_5437

Domain Start End Score
Glycosyltransferase+ 1 431 260.9
aknK_Aclacinomycin-A_2-deoxyfucose 307.0
vinC_Vicenistatin_Vicenisamine 301.0
spnP_Spinosyn_Forosamine 296.0
desVII_Pikromycin_Desosamine 290.0
cosk_Cosmomycin_2-deoxyfucose 283.0
dnrS_Doxorubicin_Daunosamine 263.0
stfG_Steffimycin_Rhamnose 261.0
schS10_Sch-47554_Aculose 250.0
cosG_Cosmomycin_Rhodosamine 250.0
chmCIII_Chalcomycin_Chalcose 246.0

Detection: predicted by Prodigal
Start: 6173353 | End: 6174649 | Frame: +

Sequence: show MRVMLMSFPTRTHIYSLAPVGWALRAAGHEVRYVGQRNPSEIDPFLQTGLESAWVGGDFDIAKHRQYGDDGASGASGQVNDPFKLAESRPERLTDEYVRAAYETTAGMIRYVNSDEFLNEALRYARRWQPDLIVWDPLIYAGAMVAEVVGAAQMRMLYAADQNARVHFEYEKLKERRPEVAWPDPLAEWMTEWLGRHGCAFDEELRFGSASICPSPSCVRFPLDVNYLPVRFVPVNRPLPMPDWALEAPTRPRVLLTLGVSNRQVHGVEQASVSELLAGLGRLDVEVIATFNKDQLASVRNVPDNVRAEAFVPMNEVLASCSAIVHQGGGATVGNAVVNGVPQLIVPGTIWSERASAVAQEKRGYGLFIDLEDITAERVRDKVARLVEEPSFRENARQVQAEMLATRTLGDLVPELEAAAARRRHRSAAT (hide)

Domain analysis:

Biosynthetic assembly:

GTr

orf_5438

Domain Start End Score
dTDP-D-glucose synthase 1 356 531.5

Detection: predicted by Prodigal
Start: 6174796 | End: 6175867 | Frame: +

Sequence: show MKALVLAGGIGSRLFPITHTGAKQLIPVANKPVLFYVIETLVDAGVTDIGIVVGGTQAQVREAVGDGSAMGARVTYIYQEEPLGLAHAVLIARDFLGDEDFVMYLGDNFIVGGIDALLRKFHAEGPAAEILLTRVDNPTDFGVAELDAGGQVVRLEEKPKNPASHLAVIGVYLFTPAVHEAIDAISPSPRGELEIVEAIQWLVNNGYPVGSATIDGYWKDTGTVTDMLEVNRSVLETLEPCTDGKVDEESEIIGRVRIERGAVVSQSRIVGPAVIGAGTVVRSSYIGPSTSIAEDCVIDTSQIEFSIVLNGAAIEGVGPIEGSLIGREAHLTRSCLTPRASHRFLIGDHCKVQVA (hide)

Domain analysis:

Biosynthetic assembly:

StrD

orf_5439

Domain Start End Score
dTDP-D-glucose 4,6-dehydratase 1 324 540.2

Detection: predicted by Prodigal
Start: 6175863 | End: 6176913 | Frame: +

Sequence: show MRVLVTGGAGFIGSCFARLLLGPDSPLPVTAVTVLDALTYAGNRENLAPVAADARLTFVHGDIRDAALVDTLVAGQDAVVHFAAESHVDRSILDASAFVGTNVVGTQILLDAALRHGLGTFLHVSTDEVYGSVEKGSSREDHPLLPTSPYAASKASSDLIALAYHRTHGLDVRVTRCSNNYGPHQFPEKLIPLFATRLLDGRTVPLYGDGGNVRDWLHVEDHCRALCAVLTDGRPGEIYNIGGGTELSNRDLTRLLLDICGAGWESVELVTDRKGHDLRYSVDSGKIRDELGWTPRNTMDTGLAATVAWYRRNRDHWQRSPGPGADPTADAPGTRAHRAARADAGSAA (hide)

Domain analysis:

Biosynthetic assembly:

StrE

orf_5440

Domain Start End Score
2,3-dehydratase 3 454 677.6

Detection: predicted by Prodigal
Start: 6176909 | End: 6178274 | Frame: +

Sequence: show MSPGPVTDAARLALSAATAEGAVMRTEDVVRWLGERRRGNRFRVERIPLDRMDGWYADDGTGDIRHRSGGFFTVEGIRARTGHGPVRVWEQPIICQREVGILGILVKEFDGVLHCLMQAKMEPGNRPLLQLSPTVQATRSNYTRVHRGARVKYIDYFTGSERVRVLADSQQSEHGSWFHRKSNRNTIVETDGDVPRDDDYCWLTLGQIAELLHHDNVINMDSRTVLACVPLPDTGEEALHPDTEIDRWLEAERARRQVHVEPLPLSAIDGWRRGTHTIDHESGRYFRVVGVSVQAGNREVTGWSQPLFEPRGLGVTAFLTRRIGGVRHVLAQARAEAGLHDSVELAPTVQCTPENYAHLAAGDRPLFLDQVLAAGRADILYEAVHSEEGGRFLGADSRCLLVEAGDRGPGDDAPSGYRWLTAGQLSRLVRRGHHVNVQARTLLACLNATAAAG (hide)

Domain analysis:

Biosynthetic assembly:

2,3DH

orf_5441

Domain Start End Score
N,N-dimethyltransferase 2 242 257.4

Detection: predicted by Prodigal
Start: 6178342 | End: 6179071 | Frame: -

Sequence: show MIVIENEQIYDEKFADVYDDIYPVRADYSDFAQQIHDLIAERVPDATTLLDVACGTGEHLVRLRDHFEVAGIDLSGPMVRVAREKLPDVPVHQGDMRDFDLGRTFDAVVCMYSSVGYLPSVEGLYSAVSTMVKHVAPGGVLVVEPWVCMEDWNGGDLVHATFRSGDRTVTRMGQWTTRDGHSCVEMHYLVGEPQSVRHFVNEQELSLFTRKEYFGAFDAAECTWEYLTEGFSGRGVFVARR (hide)

Domain analysis:

Biosynthetic assembly:

N,N-MT

orf_5442

Domain Start End Score
Glycosyltransferase+ 1 330 160.8
vinC_Vicenistatin_Vicenisamine 152.0
stfG_Steffimycin_Rhamnose 149.0
spnP_Spinosyn_Forosamine 149.0
desVII_Pikromycin_Desosamine 148.0
cosG_Cosmomycin_Rhodosamine 147.0
aknK_Aclacinomycin-A_2-deoxyfucose 147.0
unknown_Arianamycin_2-O-methyl-L-rhamnose 147.0
megDI_Megalomicin_Megosamine 145.0
dnrS_Doxorubicin_Daunosamine 141.0
nanG5_Nanchangmycin_4-O-methyl-L-rhodinose 141.0

Detection: predicted by Prodigal
Start: 6179276 | End: 6180269 | Frame: +

Sequence: show MRILLTVPSSRARLHRLAPLGWALRTAGHQVQVAGRPSFTDSITLTGLVAVPVGDGGTDDGGQEHHRLDRRSDTDALLDYFSLWRPDLVVWDSLAPAGAEAAQARGVAAVRMLGPLADRSEGDGLPGRTLDSLPPSLRTAGEPEDLAVRFLPYAGSAVLPAWLRRKPRRRRIHATLGDFASGTTVTALFDAMGGSDAEFLCELADDRIPAGTRLPGNVRLYQDAPRDAVLASCAAAVHDGGAEVTMSALAAGLPQLILTDGTTPTGLAPRVAGEGGAILADPAALRTEAIGRLLDDPEPRAGATRLRDEVAAMPGPREVVPLLAAVAGQ (hide)

Domain analysis:

Biosynthetic assembly:

GTr

orf_5443

Domain Start End Score
C-methyltransferase 9 421 486.7

Detection: predicted by Prodigal
Start: 6180303 | End: 6181572 | Frame: -

Sequence: show MLGGFRLHDTDGMPISACRACGNKALLPVLELGTQALTGCFPRSRDDVVPTGPLELVKCSPKGCGLVQLRDTPDLSLLYGDGYGYRSSIRPFMVNHLHGKVAALTGLVDLEPSDLVLDIGSNDSTLLQAYPADGPTLVGIDPTGEKWRPYYPAHIDLISDFFSREAFGARHGDRKAKIVTSIAMFYDLPDPVQFMRDVHAVLADDGVWMIEMSYLPSMLESNAYDTVCHEHLEYYTLRQIEWMAERAGLTVVQAEITDVYGGSLSVTLAKAPTRHKIDVASIERLRQAEDRIGLDTMAPFDAFAARVREHRAALRDFLDRSREAGRLTLGYGASTKGNVILQYCGITEEDLPCIGEVNAEKAGCFTPGSNIPIVSEEDAKARRPDQLLVLPWVFRDGFVEREQEFLAGGGTMVFPLPRLSA (hide)

Domain analysis:

Biosynthetic assembly:

CMT

orf_5445

Domain Start End Score
Glycosyltransferase+ 1 429 305.4
aknK_Aclacinomycin-A_2-deoxyfucose 355.0
desVII_Pikromycin_Desosamine 339.0
spnP_Spinosyn_Forosamine 326.0
vinC_Vicenistatin_Vicenisamine 318.0
cosk_Cosmomycin_2-deoxyfucose 312.0
chmCIII_Chalcomycin_Chalcose 300.0
aknS_Aclacinomycin-A_Rhodosamine 290.0
megCIII_Megalomicin_Desosamine 287.0
megDI_Megalomicin_Megosamine 287.0
snogE_Nogalamycin_Nogalose 286.0

Detection: predicted by Prodigal
Start: 6183049 | End: 6184339 | Frame: +

Sequence: show MRVLFTVFASRSHLYNMVQLAWALRSSGHEVCVAGQPDLVDMITSTGLPAVPVGKELTPGSDGWRGKGMQNLDVLSRGLAAPHEEQRGGGWEYVLGEWTMACGVRYESLADQRMVDDLVKFARTWEPDLVVWDAMTFAGPVAAKACGAAHARMNFGRDYIYRLYQDYVALRDEQPPEQRDDPLEDWFTGRLARIGHTYDPSMAKEMLTGQWTIDPLPDWLRVPTDLPTVHASYVPYNGRITIADWVYRKPEVPRVCLSFGVSLREHVGGAIVPVEDMLGAVADLDIEVIATLDASQIDAAAVPDNVTLVGFVSLNELMPSCSVAVHQGGYGTYSNALLHGVPSLIIPHPFWDEAECGVLFEKRGAGLCLTPEEFTPEAFREKLVRLLEEPHFRSTARELQQEIHDAPKPLDVVPLLEQLTAQHRGRDS (hide)

Domain analysis:

Biosynthetic assembly:

GTr

orf_5446

Domain Start End Score
3-ketoreductase 8 333 382.2

Detection: predicted by Prodigal
Start: 6184335 | End: 6185352 | Frame: +

Sequence: show MTTDSESVARTPLRVGVLGCAQVAWGRTLPAFADSDAARVVAVASRDKEKADRFARRFGCDAVEGYEALLKDPGVEAVYLPLPTGLHTEWTERALRAGKHVLAEKPIATTHREAARLVALADGLGLCLMENRMFVHHRQHTAVREFVADGAIGELRSFTGTMCVPPLPADDVRYRPDLGGGALLDVGFYPLHAALHFLSGRLDVLGATLRHDPRYGVDVGGGVLLRAEDAVTAHLTFGFEHGYRSHYELHGSEGRLTLERAFTPSAAWQPVVRIERGNRTEEITLPPSHQRREIIDVFAAAVRDGEPPAGHLATALRGVALSEAVRDAAGRGGGHGV (hide)

Domain analysis:

Biosynthetic assembly:

3KR

orf_5447

Domain Start End Score
4-aminotransferase 3 391 450.9

Detection: predicted by Prodigal
Start: 6185341 | End: 6186532 | Frame: +

Sequence: show MGSELAILGGEPAFAEALHVGRPNIPDEGLVLERIRQAIDRRWLTSFGPLVKEFEEELARQAGVKHCIATCNATIALQVLIRAGGLRGEVVMPSFTFIATAHTLRWEGVTPVFCDIDEETGNIDVAHARKVITERTTGIMGVHLWGNPAPTEELAALADEHGLRLFYDSAHAIGGTRLGRPVGGFGDAEVYSFHATKFVNAFEGGAIVTDDDALAERVRLTHNYGRGEGNHVSCVGTNAKMTEVAAAMGLTSLENMAYLIDVNRERFDRYAAGLADVPGIRLRRPSPGNTVNHQYVVIEVDTPGTGLSRDDLVATLQAENVLARTHFHPSCHRTEPYVHEQAVSAPLPLPHSEALSDRVVQLPTGTGVTLDQVDQVCALIGRAVRHAPAVKACLA (hide)

Domain analysis:

Biosynthetic assembly:

4-AmT