Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 2

Nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_236 Kyn
orf_238 TE
orf_240 TrpTTE
orf_241 CMeGluTC
orf_242 AlaTE
orf_243 COrnTCAspTC
orf_244 C*TrpTCAsnTECAspTCThrTCGlyT
orf_245 T
orf_246 C10
orf_247 AMR12
orf_248 AMR13

Cluster:

  orf_240orf_241orf_242orf_243orf_244 orf_246  

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 1
    (maximum 500)
  • Subgraph combinations: 1
  • Total combinatorial plans: 8 (maximum 1,000)
  • Scaffolds generated: 4 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA

Analysis

orf_236

Domain Start End Score
Tryptophan dioxygenase 14 244 438.4

Detection: predicted by Prodigal
Start: 344191 | End: 344929 | Frame: -

Sequence: show MTAQDTRTTGSDGGGRGATYHESPTYGELLRLEDLLNVAHLRDAAAPVLFLATHQSAEIWFGIVLRHLEEIRAALTDDDPDTALHLLPRLPEIFELLVRHFDMLATLSTEEFGKIRAGLGTASGFQSAQYREIEFLCGLRDHRHISTPGFTETERRRLRERARQPSVAEAYDAFRTRCANGKDAERIGEALLRFDERVTVWRARHAALAERFLGPLEGTAGTAGADYLWRVTRHRLFPPEAWGG (hide)

Domain analysis:

Biosynthetic assembly:

Kyn

orf_238

Domain Start End Score
Thioesterase 10 181 23.7

Detection: predicted by Prodigal
Start: 345995 | End: 346811 | Frame: -

Sequence: show MRATSRMIQVNGARIACSDSGCGDPVLMIAGTGSTGRVWDAYQVPDLHAAGFRTITFTNRGVPPSDECERGFTLADLAADTAALIEQVAGGPCRVVGTSLGAQVAQEVALARPDLVTQAVFMATRGRTDAMRAAATRAAAALYDSGVELPPAYAAAVRALQNLSPHTLRDRHQVEDWLPLEYAERDGPGVRAQLELGLLPDRLADYRDITVPCLVIAFEDDVVTPPYLGREVADAIPGARFETVPRCGHYGYLEDASAVNKILRDFFRTS (hide)

Domain analysis:

Biosynthetic assembly:

TE

orf_240

Domain Start End Score
Adenylation+ 187 585 340.2
Tryptophan 26 398 560.2
Phenylalanine 26 398 534.5
Tyrosine 26 398 484.9
Alanine 26 398 481.0
Arginine 26 398 468.4
Lysine 26 398 468.0
Serine 26 398 452.1
Ornithine 26 398 440.9
β-hydroxy-phenylalanine 1 398 439.7
2,3-dehydroaminobutyric acid 273 398 118.7
Thiolation 693 757 57.3
Thioesterase 758 889 112.5

Detection: predicted by Prodigal
Start: 347149 | End: 350239 | Frame: -

Sequence: show MNTLVLRTDVSGDPTFAELLARVRATDLDAYAHQDVPFERLVEVLNPERSLLRHPLFQILLAFQNTEDRSISDRPGTLLPDLQVTEQPLDAGTAKFDLAFAFTERPPEKGEPSGITGIVEYHADLYDEGTVRQIADCFVQFLDAAVHAPGTRVDAVGLLPEHTLHKLLTRSRGTVTGLPPATLPELFEARVAAHPGHIAVEVAGRRPATTTYDALNRRANRLARLLTDRGVRPEQRVAIALPRSADLVTAWLGILKAGAVCVPVDPAYPDDRIAHMAADAAPALLIASAATRDRMLPTGIPVLDLDDPAVTAALAAAPDGNPRGTGLLPAHPAYVIYTSGSTGTPKGVVVTHEGIPALAATQQEALRAGPGDRVLQLVSTSFDASVWDLCSALLSGATLVLAPDADLFGDELAAALTAHRITHVTLPPAALAAVPAGAAPPRLTVTVTGDVCGPQLVDRWAGGERRILNGYGPTEVTVGATYAVCERTGDGAPVPIGAPWPDQRVYVLDHRLRPVPAGCVGEIYVAGAGLARGYLGRPGQTAERFVADPFGAPGERMYRTGDLARRRSDGHLLFEGRADTQVKIRGFRVELAEIEAALASHPGVEDAVVTVYDDGLGDQRLVAYVTGGPGTPSAAALRAHLASRLPRHMVPGDVLTLDALPLTANGKVDRTALPGPGTQTAAPGRAPQSPQERVLCALFADVLGRETVGVDEGFFDLGGHSLLATRLAARVRAALGVEISVRTLFEAPTPALLASACTADAAAYDPFETVLPLRRTGSRPPLFCVHAGMGLSWAYAGLLSHLDADVPVYGLQARRLTAPGGLPGSVEEMAEDYAGEIRRLCPDGPYRLLGWSFGGTVAHAVATRLQQQGHTVELLAVLDAYPVTGARPAEVDEQRIVADYLAQLGSPVAPERLEGDAWLPEFLEFVRRTDGPARDFDAGRILAMKDVFLNNARLTRRFTPGVFTGDMVFFASARPGSEQAAERVGLWHPHVTGDLDLHLIDCAHEEMTDPAALTRIGPVLAARLGAGT (hide)

Domain analysis:

Biosynthetic assembly:

TrpTTE

orf_241

Domain Start End Score
Condensation+ 6 302 221.9
cdaps3_C1_DCL 329.0
cdaps1_C5_DCL 286.0
act3_C1_DCL 281.0
cdaps2_C1_DCL 277.0
compl4_C1_DCL 273.0
compl3_C5_DCL 266.0
compl2_C1_DCL 259.0
compl3_C1_DCL 249.0
compl3_C3_DCL 242.0
compl1_C1 241.0
Adenylation+ 465 863 344.5
Methyl-glutamate 23 398 783.4
Asparagine 23 398 647.4
Aspartate 23 398 584.4
Glutamate 23 398 510.9
Glycine 23 398 495.2
β-hydroxy-asparagine 1 398 446.8
Arginine 23 398 414.0
β-hydroxy-aspartic acid 1 398 385.8
Leucine 23 398 380.6
3-aminonon-5-enoic acid 1 398 109.3
Thiolation 974 1038 46.4
Condensation+ 1055 1309 168.6
cdaps1_C6_LCL 244.0
cdaps2_C3_LCL 234.0
cyclom1C2_LCL 228.0
cdaps2_C2_LCL 228.0
cdaps3_C2_LCL 227.0
cdaps1_C7_LCL 226.0
cyclom1C4_LCL 225.0
cdaps1_C3_LCL 223.0
cdaps1_C2_LCL 223.0
prist2_C3_LCL 222.0

Detection: predicted by Prodigal
Start: 350235 | End: 354288 | Frame: -

Sequence: show MTQRAMEDILPLTPLQEGLLFHSVYDEQSVDVYTVQVVVDLEGPVDPEALRAAAAALLRRHANLRAAFRYERLQRPVQIIPREVAVPWEHTDVAKLEGAEQKAEIERLLHDQRWRRFDLTAPPLLRFLLVRTGHDRHRFALTFHHILMDGWSMPVLLRELITLYRTGDETALPWVRPYRDYLAWISRRDRDEAGRAWSKALAGVDEATLVAPGADRAAEPPLWTESRLEPDLAATLAARAREFGVTLNTLVQAAWALVLGRLTGRDDVVFGVTVSGRPPELAGVEDMVGLFINTVPLRAELLPHESLRDFTVRLQREQIQLLDHQYERLAVIQRLAGRTELFDTVMVFENYPVAAASSAGADGPAAEPRVADVHVRDAMHYPLGLLVLPGPPLRLRFGHRPSALPAERVTTIRDSLVRALELMADQPDLAVGRADILGEEEKQHLLTGLNDTHRDVPPLTVPGMIEAQAARTPGRPAVHARDGELSYAELNARANRLARHLAAAGVGPEQYVTLLLPLSARMVVAALAVMKTGAAYVPVDPEYPADRIAYMLGDIGPALVLTDSRSAAAMPAGPARVLTLDDDALDTGVRALPEHDLGTDGIAPLPDQPAYVIYTSGSTGRPKGVVILHRSVTGYLLRTIEEYPEAAGKAFVHSPVSFDLTVGALYAPLVSGGCLRLGSFTDDKILDLGEDSPTFMKATPSHLAVLDSLPDEISPTGAITLGGEQLLSETLDPWRARHPGVTVFNVYGPTETTINCAEHRIAPGTTLPPGPVPIGRPLWNTRLYVLDGGLRVVPTGVAGELYVAGAGLARGYLGRPGLTAERFVACPFGAPGERMYRTGDLVRWRTDGTLEFVGRVDDQVKVRGFRIELGEVEATVAATPGVARAIVAVREDRPGDQRLVAYVTPADVDPTGGLPSAVTAHAAARLPAYMVPSAVVVLHEVPLTPNGKINRAALPAPEAVSGAGFRAPGTAREEVLCGLFAEVLGLERVGTADDFFELGGHSLLATRLVSRVRSVLGVELGVRALFDAPTPGRLDRLLGERSGAPVRAPLTARERTGRDPLSYAQQRLWFLHELEGHGATYNIPLALRLTGPLDVTALEAALTDVVARHESLRTLIARDGTGTAWQHILPTGDPRARITLEAVPLHRDELAGRLAEAARHPFDLTAEIPVRATVFRTERDDHTLLVVTHHIASDRWSREPFLRDLSAAYAARRAHSAPELPPLSVQYADYAAWQRDVLGTEDDGTSEMAGQLAHWRGRLAGLPQGLDLPTDRPRRPDVGRRGGRCRLEIPAALHRDIVTLARVTSTTGWWSRRPSPVCCRGWARAPTSPSARRSRAAPTRPPSTSSGSS (hide)

Domain analysis:

Biosynthetic assembly:

CMeGluTC

orf_242

Domain Start End Score
Adenylation+ 2 383 331.8
Alanine 14 381 675.0
Aspartate 14 381 519.0
Serine 14 381 507.6
Phenylalanine 14 381 474.7
Arginine 14 381 442.8
Lysine 14 381 437.6
Tryptophan 14 381 435.8
Glutamate 14 381 428.9
Piperazic acid 5 381 422.3
α-ketoisovalerate 3 381 108.8
Thiolation 490 553 53.8
Epimerization+ 592 884 100.0
cdaps1_C4E 186.0
cdaps2_C4E 166.0
tioR_C2E 160.0
compl3_C4E 152.0
micro1_C2E 139.0
prist1_C3E 137.0
act2_C3E 126.0
compl3_C2E 125.0
surfa5_C4E 122.0
mycos2_C2E 119.0

Detection: predicted by Prodigal
Start: 354284 | End: 357497 | Frame: -

Sequence: show MTRRFSLYEGEVLSYRELDARANRLAGLLVGRGAGPEHFVGVALPRGLDLIVALLAVLKSGAAYVPLDPEYPAERLVHMVTDAAPVVVVTSTDVRTLRTVPRVELDDEATRATLVAAPATGPDVKMSASHPAYVIYTSGSTGRPKGVVISHGSLANFLAWAREDLGAERLRHVVLSTSLSFDVSVVELFAPLSCGGTVEIVRNLLALVDRPGRWSASLVSGVPSAFAQLLEAGLDRADVGMIALAGEALSARDVRRVRAVLPGARVANFYGPTEATVYATAWYGDTPMDAAAPMGRPLRNTCVYVLDDGLRVVPVGVVGELYVAGVGLARGYLGRVGLTAERFVACPFGARGERMYRTGDLVRWRVDGTLEFVGRADDQVKVRGFRVELGEVEGAVAAHPDVVRAVVVVREDRPGDHRLVAYVTGVDTGGLSSAVMRAVAERLPAYMVPSAVVVLDEIPLTPNGKVDRAGLPVPVVSVAGFCAPSSPREEVLCGLFAEVLGVERVGVDDGFFDLGGDSILSIQLVARARRAGLELSVRDVFEGRTVRALAAVVRGSDAGAVGVVGGAEIVLPGVGEVERWPVVEWLAERGGGSLGGVVRGFNQSVVLAVPAGLVWEELRVLLGAVRDRHEAWRLRVLDSGALCVDGVVPDDGSWIVRCDLSGMGVDGQVDAVRAAAVEARAWLDPSVGRVVRAVWLERGGDRSGVLVLVAHHLVVDGVSWRVVLGDLAEGWAQVRSGGRVELGVVGTSLRGWAAALAEQGRRGERAGEVELWSRMVRGADVLVGSRAVDGAVDVFGGVVSVDSRASVSVSRALLTEVPSVLGVGVQEVLLAAFGLAVARWRGRGGPVVVDVEGHGRNEDAVRGADLSRTVGWFTSVYPVRVPVSASWDEVRAGGPVVGRVVREVKETLRSLPDQGLGYGILRYLDPEHGPALARHATPQFGFNYLGRFTTGTDDTGDEGMTDWVPVSGPFAVGAGQDPELPVAHAVEFNAITLDTPEGPRLGVTWSWPTTLLPESRIRELARYWDEALEGLVEHARHPEAGGLTPSDVGLAELSFAEIELLEDDWRTQG (hide)

Domain analysis:

Biosynthetic assembly:

AlaTE

orf_243

Domain Start End Score
Condensation+ 9 302 192.4
cdaps1_C5_DCL 257.0
cdaps2_C1_DCL 255.0
cdaps3_C1_DCL 245.0
act3_C1_DCL 240.0
compl4_C1_DCL 239.0
compl3_C5_DCL 234.0
compl3_C1_DCL 229.0
compl1_C1 222.0
compl2_C1_DCL 209.0
compl3_C3_DCL 204.0
Adenylation+ 463 868 329.7
Ornithine 23 405 757.4
Aspartate 23 405 493.7
Hydroxyacetyl-ornithine 23 405 486.3
Lysine 23 405 463.3
Arginine 23 405 456.2
Tryptophan 23 405 427.2
Phenylalanine 23 405 424.5
β-hydroxy-aspartic acid 1 405 366.8
Glutamate 23 405 360.5
Para-aminophenylalanine activation 6 404 109.1
Thiolation 975 1039 46.2
Condensation+ 1055 1357 240.5
cdaps3_C2_LCL 340.0
cdaps2_C2_LCL 340.0
cdaps1_C2_LCL 336.0
cdaps1_C6_LCL 335.0
cdaps2_C3_LCL 335.0
cdaps1_C7_LCL 333.0
act2_C2_LCL 328.0
act3_C3_LCL 328.0
act3_C2_LCL 322.0
cyclom1C2_LCL 320.0
Adenylation+ 1534 1938 291.3
Aspartate 23 404 748.5
Asparagine 23 404 541.4
Methyl-glutamate 23 404 429.9
β-hydroxy-asparagine 1 404 420.3
Glutamate 23 404 395.0
Phenylalanine 23 404 379.3
Hydroxyphenylglycine 23 404 378.1
β-hydroxy-aspartic acid 1 404 374.1
Tryptophan 23 404 352.1
Proline 254 404 109.3
Thiolation 2046 2110 49.9
Condensation+ 2127 2432 217.8
cdaps1_C6_LCL 333.0
cdaps2_C3_LCL 322.0
cdaps1_C7_LCL 322.0
cdaps2_C2_LCL 321.0
prist2_C3_LCL 313.0
cdaps3_C2_LCL 309.0
cyclom1C1_LCL 303.0
bacil2_C2_LCL 303.0
cyclom1C2_LCL 301.0
act3_C2_LCL 301.0

Detection: predicted by Prodigal
Start: 357465 | End: 365313 | Frame: -

Sequence: show MVNRRSKVVEEILPVSALQEGLLFHSSFAAADGVDVYAGQLAFDLVGAVDTGRLRAAVESLVARHGVLRSSYRQARSGEWVAVVARRVATPWRAVDARDGATDAAAVAREERWRPFDLGRAPLARFVLVRTDDDRFRFVITYHHVILDGWSLPVLLRELLALYGSGADPSVLPPVRPYGDFLRWAAARDDAAAETAWRDALTGLDEPSLVAPGASPDGVVPASVHAELDKAGTENLAAWARHRGITQATAVRAAWALVLGQHTGRDDVVFGVTVSGRPAELAGAEHMVGLFINTVPLRTVLDPADTLGTFAARLQAEQTTLLEHQHVRLSDIQRWAGHKELFDTIVVFENYPIGHSGPGSIRTDDFTVTATEGSDATHYPLTLTAVPGETLRLKLDHRPDLVDTTTATALLRRVTRVLETATDDTGHTLARLDLLDDDERHRLLRGWNDTTREQPPTYYHQEFEEQARRRPHDTALVFTSTSWTYEELNDRANRLARLLVAAGAGSDDFVALAFPRSAESVVAILAVLKAGAAYLPLDMDQPAERLTGILADAHPTVVLTTTTATPLPHPGRTLVLDSPTTARALAAAPAHNLTDADRRTPLNARNAAYIIHTSGSTGRPKGVVIEHRSLANLFHDHRRALIEPHAAGGSRLKAGLTASLSFDTSWEGLICLAAGHELHLIDDDTRRDAERVAELIDRQRIDVIDVTPSFAQQLVETGILDEGRHHPAAFMLGGEGVDAKLWTRLSDVPGVTSYNYYGPTEFTVDALACTVGIAPRPVIGHPLDNTAAYILDGFLRPVPEGVAGELYLAGTQLARGYAGRPGLTAERFVACPFGAPGERMYRTGDLVRRSPGGVVEYLGRVDDQIKLRGFRIEPAEIELALAGHPAVAQNVVLLHRSATGEARLVAYVVPGTPVDPRELTGHLAARLPAYMVPSAFVLLDTLPLTPNGKLDRGALPEPAFGTAPRPERPRTPVEEILCGLYADVLGLPSFGADDDFFDAGGHSLLASKLVSRIRTNLKTELNVRALFEHRTVSSLATALHRAAQAGPALTAGPRPARIPLSYAQRRLWFLNRLDRDSAAYNMPVALRLRGPLDSTAMCAALTDVAERHEALRTVFEEDRDGAHQIVLPATGLGPLLTVTGADGTTLRALITEFVRRPFDLAAEIPFRAALFRVGDEEHVLVVVLHHIAGDGWSMGPLARDVAEAYRARAAGRAPDWEPLPVQYADYALWQREVLGAEDDETGELSAQLAHWRTRLAGAPAELTLPTDRPRPAVASTAGDRVEFTVPAGLHQALADLARAHGATVFMVVQAALAVLLSRLGAGDDIPIGTPVAGRTDEATEELIGFFVNTLVLRTDVSGDPTFAELLARVRATDLDAYAHQDVPFERLVEVLNPERSLARHPLFQVMLTFNVPDMDGVGSALGNLGELEVSGEAIRTDQTKVDLAFTCTEMYAADGAASGMRGVLEYRLDVFGAVQARETTERLVRVLEGVVSGGGGVSVSGVDVLGVGERERLLGWGVGGPVPVVPGGGLVGLFEERVRADADAVAVRGAGVVWSYGELNARVNVVARWLVGRGVGAECGVGVVMGRGVDVVVMLLAVAKAGGFYVPVDPEWPVERVGWVLADAGVGLVVVGEGLSHVVGDFPGGEVFEFSRVVRESCLVELVAADGVEVRNVTDGERASRLLPGHPLYVVYTSGSTGRPKGVVVTHASVGGYLARGRDVYAGAVGGVGFVHSSLAFDLTVTVLFTPLVSGGCVVLGELDESAQGVGASFVKVTPSHLGLLGELEGVVAGNGMLLVGGEALSGGALREWRERNPGVVVVNAYGPTELTVNCAEFLIAPGEEVPDGPVPIGRPFAGQRMFVLDAALRVVPVGVVGELYVAGVGLARGYLGRAGLTAERFVACPFGAPGERMYRTGDLVRWRVDGALEFVGRADDQVKVRGFRVELGEVEGAVAAHPDVVRAVVVVREDRPGDHRLVAYVTGVDTGGLSSAVMRAVAERLPAYMVPSAVVVLDEIPLTPNGKVDRAALPVPGVEAGAGYRAPVSPREEVLCGLFAEVLGLERVGVDDDFFGLGGHSLLATRLISRVRAVLGVEAGVRALFEAPTVSRLERLLRERSALGVRVPLVARERTGREPLSFAQQRLWFLEELEGPGAAYNIPMALRLAGVLDVEALHQALIDVIARHESLRTLIAQDAGTAWQHILPVDDPRTRPGLPLVDIGADALQERLDEAAGRPFDLAADLPVRATVFRLTDNDHILLVVAHHVAFDAMSRVPFIRNVKRAFEARTNGAAPDWRPLPVQYADYAAWQRDVLGTEDDESSELSAQLAYWRTQLASLPAELALPTDRARPAVASYEGGKVEFTVPAGVYDGLVALARAEGVTVFMVVQAALAALLSRLGAGDDIPIGTPIAGRTDQATEDLIGFFVNTLVLRTDVGDPTFAELLARVRATDLDAYAHQDIPFERLVEAVNPERSLARHPLFQVMLTFDNTIDREVTEGFAGLGVEGLPLGAGAVKFDLLFGLSEVGGELRGAVEYRCDLFDHPTVAQLAERLVRVLERVASDASVRTGELPVVGEAERARVLTEWNDTGVPGVPETFLELFEAQVAARGDAPVFFVRG (hide)

Domain analysis:

Biosynthetic assembly:

COrnTCAspTC

orf_244

Domain Start End Score
Condensation+ 4 301 120.1
DptA_-_Daptomycin_C-starter 586.0
Taromycin_C-starter 211.0
bacil2_C1_start 182.0
act2_C1_start 179.0
cdaps1_C1_start 175.0
pstB_friulimicin 172.0
antE_Antimycin_C-starter 167.0
CdaPS1_-_Calcium-dependent_antibiotic_C-starter 164.0
LptA_-_A54145_C-starter 163.0
Skyllamycin_C-starter 151.0
Adenylation+ 464 848 317.0
Tryptophan 23 384 693.9
Phenylalanine 23 384 448.7
Serine 23 384 408.7
Glycine 23 384 405.5
Leucine 23 384 402.4
Tyrosine 23 384 398.5
Hydroxyphenylglycine 23 384 389.0
Hydroxyacetyl-ornithine 23 384 388.5
Lysine 23 384 387.2
Allo-threonine 244 384 108.6
Thiolation 957 1021 51.5
Condensation+ 1036 1334 222.3
act2_C2_LCL 301.0
cdaps1_C2_LCL 300.0
cdaps3_C2_LCL 294.0
cdaps2_C2_LCL 292.0
cdaps2_C3_LCL 292.0
act3_C3_LCL 290.0
cyclom1C2_LCL 288.0
bacil2_C2_LCL 288.0
prist2_C3_LCL 288.0
act3_C2_LCL 288.0
Adenylation+ 1503 1907 334.6
Asparagine 23 404 868.0
Aspartate 23 404 558.7
Glycine 23 404 503.5
Glutamate 23 404 472.8
Methyl-glutamate 23 404 461.9
Phenylalanine 23 404 439.3
β-hydroxy-asparagine 1 404 434.8
Alanine 23 404 426.6
β-hydroxy-aspartic acid 1 404 407.3
2-carboxy-6-hydroxyoctahydroindole 252 404 111.1
Thiolation 2017 2080 56.4
Epimerization+ 2113 2410 120.1
cdaps1_C4E 196.0
cdaps2_C4E 179.0
compl3_C4E 158.0
prist1_C3E 158.0
tioR_C2E 147.0
act2_C3E 143.0
micro1_C2E 139.0
compl3_C2E 135.0
surfa5_C4E 127.0
mycos2_C2E 125.0
Condensation+ 2620 2912 194.8
compl3_C1_DCL 244.0
act3_C1_DCL 241.0
cdaps2_C1_DCL 234.0
compl4_C1_DCL 223.0
cdaps1_C5_DCL 222.0
cdaps3_C1_DCL 222.0
compl3_C3_DCL 219.0
compl2_C1_DCL 216.0
compl3_C5_DCL 215.0
compl1_C1 202.0
Adenylation+ 3083 3484 309.0
Aspartate 23 401 784.3
Asparagine 23 401 561.4
Methyl-glutamate 23 401 423.0
Glutamate 23 401 412.3
β-hydroxy-asparagine 1 401 411.3
Phenylalanine 23 401 397.1
β-hydroxy-aspartic acid 1 401 393.1
Glycine 23 401 376.8
Lysine 23 401 369.8
Pipecolic acid 5 401 110.9
Thiolation 3592 3656 52.0
Condensation+ 3673 3978 240.8
cdaps2_C3_LCL 341.0
prist2_C3_LCL 340.0
cdaps1_C6_LCL 340.0
act3_C2_LCL 328.0
cdaps2_C2_LCL 324.0
act3_C3_LCL 324.0
act2_C2_LCL 316.0
cyclom1C1_LCL 315.0
cdaps1_C7_LCL 315.0
cdaps3_C2_LCL 312.0
Adenylation+ 4149 4554 374.4
Threonine 23 405 885.1
Threonine 23 405 706.3
Allo-threonine 23 405 643.5
Serine 23 405 598.5
Alanine 23 405 520.1
Phenylalanine 23 405 518.6
2,3-dehydroaminobutyric acid 1 405 498.1
Glycine 23 405 494.8
2,3-dehydroaminobutyric acid 23 405 493.3
Pipecolic acid 6 405 115.4
Thiolation 4664 4728 45.8
Condensation+ 4744 5045 217.9
act3_C2_LCL 340.0
act2_C2_LCL 339.0
prist2_C3_LCL 335.0
act3_C3_LCL 335.0
cdaps1_C2_LCL 335.0
cyclom1C2_LCL 333.0
cdaps2_C2_LCL 330.0
cyclom1C4_LCL 328.0
cdaps1_C6_LCL 328.0
cyclom1C6_LCL 326.0
Adenylation+ 5221 5616 347.6
Glycine 23 395 749.4
Glycine 23 395 519.1
Alanine 23 395 444.3
Phenylalanine 23 395 442.3
Arginine 23 395 432.1
Serine 23 395 428.0
Aspartate 23 395 423.4
Glutamate 23 395 419.5
Threonine 23 395 417.7
Tyrosine 23 156 112.7
Thiolation 5724 5788 48.1

Detection: predicted by Prodigal
Start: 365306 | End: 382799 | Frame: -

Sequence: show MDMQSQRLGVTAAQQSVWLAGQLADDHRLYHCAAYLSLTGSIDPRTLGTAVRRTLDETEALRTRFVPQDGELLQILEPGAGQLLLEADFSGDPDPERAAHDWMHAALAAPVRLDRAGTATHALLTLGPSRHLLYFGYHHIALDGYGALLHLRRLAHVYTALSNGDDPGPCPFGPLAGVLTEEAAYRDSDNHRRDGEFWTRSLAGADEAPGLSEREAGALAVPLRRTVELSGERTEKLAASAAATGARWSSLLVAATAAFVRRHAAADDTVIGLPVTARLTGPALRTPCMLANDVPLRLDARLDAPFAALLADTTRAVGTLARHQRFRGEELHRNLGGVGRTAGLARVTVNVLAYVDNIRFGDCRAVVHELSSGPVRDFHINSYGTPGTPDGVQLVFSGNPALYTATDLADHQERFLRFLDAVTADPDLPTGRHRLLSPGTRARLLDDSRGTERPVPRATLPELFAEQARRTPDAPAVQHDGTVLTYRDLHRSVERAAGRLAGLGLRTEDVVALALPKSAESVAILLGIQRAGAAYVPLDPTHPAERLARVLDDTRPRYLVTTGHIDGLSHPTPQLAAADLLREGGPEPAPGRPAPGNAAYIIQTSGSTGRPKGVVVTHEGLATLAADQIRRYRTGPDARVLQFISPGFDVFVSELSMTLLSGGCLVIPPDGLTGRHLADFLAAEAVTTTSLTPGALATMPATDLPHLRTLIVGGEVCPPEIFDQWGRGRDIVNAYGPTETTVEATAWHRDGATHGPVPLGRPTLNRRGYVLDPALEPVPDGTTGELYLAGEGLARGYVAAPGPTAERFVADPFGPPGSRMYRTGDLVRRRSGGMLEFVGRADGQVKLRGFRIELGEVQAALTALPGVRQAGVLIREDRPGDPRLVGYIVPAPGAEPDAGELRAALARTLPPHMVPWALVPLPALPLTSNGKLDRAALPVPAARAGGSGQRPVTPQEKTLCALFADVLGVTEVATDDVFFELGGHSLNGTRLLARIRTEFGTDLTLRDLFAFPTVAGLLPLLDDNGRQHTTPPLPPRPERLPLSHAQQRLWFLDQVEGPSPAYNIPTAVRLEGPLDIPALAVALQDVTNRHEPLRTLLAEDSEGPHQVILPPEAARPELTHSTVAPGDLAAALAEAARRPFDLAGEIPLKAHLFGCGPDDHTLLLLVHHTAGDGASVEVLVRDLAHAYGARRAGDAPHFEPLPLQYADHTLRRRHLLDDPSDSTQLDHWRDALAGLPEQLELPTDHTRPAVPTRRGEAIAFTVPEHTHHTLRAMAQAHGVTVFMVMQAALAALLSRHGAGHDIPLGTPVAGRSDDGTEDLVGFFVNTLVLRNDVSGDPTFAELVSRVRAANLDAYAYQDVPFERLVDVLKPERSLSWHPLFQIMIAYNGPATNDTADGSRFAGLTSRVHAVHTGMSKFDLSFFLTEHADGLGIDGALEFSTDLFTRITAERLVQRYLTVLEQAAGAPDRPISSYELLGDDERALLAQWNDTAHPTPPGTVLDLLESRAARTPDRPAVVENDHVLTYADLHTRANRLARHLITAHGVGPERLVAVALPRSAELLVALLAVLKTGAAYVPLDLTHPAERTAVVLDDCRPAVILTDAGAARELPRRDIPQLRLDEPEVHAAIAEQPGGPVTDRDRTCVTPVSGEHVAYVIYTSGSTGRPKGVAVEHRSLADFVRYSVTAYPGAFDVTLLHSPVTFDLTVTSLFPPLVVGGAIHVADLTEACPPSLAAAGGPTFVKATPSHLPLLTHEATWAASAKVLLVGGEQLLGRELDKWRAGSPEAVVFNDYGPTEATVNCVDFRIDPGQPIGAGPVAIGRPLRNTRVFVLDGGLRAVPVGVVGELHVAGEGLARGYLGQPGLTAERFVACPFGDAGERMYRTGDLVRWRADGMLEFVGRVDDQVKVRGFRIELGEVEAAVAACPGVDRSVVVVREDRPGDRRLVAYVTAAGDEAEGLAPLIVETAAGRLPGYMVPSAVVVLDEIPLTPNGKVDRAALPAPRVAPAAEFRVTGSPREEALCALFAEVLGVERVGVDDGFFDLGGDSILSIQLVARARRAGLEVSVRDVFEHRTVRALAGVVRESGGVAAAVVDSGVGAVERWPVVEWLAERGGGGLGGAVRAFNQSVVVATPAGITWDELRTVLDAVRERHDAWRLRVVDSGDGAWSLRVDAPAPGGEPDWITRHGMASADLEEQVNAVRAAAVEARSRLDPLTGRMVRAVWLDRGPDRRGVLVLVAHHLVVDGVSWRIVLGDLGEAWTQARAGGHVRLDTVGTSLRGWAAALAEQGRHGARATEANLWAQMVHGSDPLVGPRAVDPSVDVFGVVESVGSRASVGVSRALLTEVPSVLGVGVQEVLLAAFGLAVTRWRGRGGSVVVDVEGHGRNEDAVPGADLSRTVGWFTSIYPVRLPLEPAAWDEIRAGGPAVGRTVREIKECLRTLPDQGLGYGILRYLDPENGPALAQHPTPHFGFNYLGRVSVSADAASLDEGDAHADGLGGLVGGRAAADSDEEQWADWVPVSGPFAVGAGQDPVLPVAHAVEFNAITLDTPDGPRLSVTWSWPTTLLSESRIRELARFWDEALEGLVAHARRPDAGGLTPSDLPLVALDHAELEALQADVTGGVHDILPVSPLQEGLLFHSSFAADGVDVYVGQLTFDLTGPVDADHLHAVVESLVTRHDVLRTGYRQAQSGEWIAVVARQVHTPWQYIHTLDTDADTLTNDERWRPFDMTQGPLARFTLARINDTHFRFIVTYHHVILDGWSVAVLIRELFTTYRDTALGRRPEVPYSPPRRDFMAWLAERDQTAAGQAWRSALAGLAEPTVLALGTEGSGVIPEVLEEEISEELTSELVAWARGRGVTVASVVQAAWALVLGRLVGRDDVVFGLTVSGRPAEVAGVEDMVGLFVNTIPLRARMDPAESLGAFVERLQREQTELLEHQHVRLAEVQRWAGHKELFDVGMVFENYPMDSLLQDSLFHGSGLQIDGIQGADATHFALNLAVVPLPAMRFRLGYRPDVFDAGRVRELWGWIVRALECVVCERDVPVSGVDVLGAGERETLLGWGAGAEPGVRALPGAGAGAGAGLVGLFEERVRTDPDAVAVRGAGVEWSYAELNARANAVARWLIGRGVGPERGVGVVMDRGPDVVAMLLAVAKSGGFYLPVDPQWPTERIDWVLADAGIDLAVVGENLAAAVEAVRDCEVVDYAQIARETRLNEQAATDAGDVTDGERVSALLSGHPLYVIYTSGSTGLPKGVVVTHASVGAYLRRGRNAYRGAADGLGHVHSSLAFDLTVTVLFTPLVSGGCVTLGDLDDTANGLGATFLKATPSHLPLLGQLDRVLAPDATLLLGGEALTAGALHHWRTHHPHTTVINAYGPTELTVNCAEYRIPPGHCLPDGPVPIGRPFTGHHLFVLDPALRLTPPDTIGELYVAGDGLARGYLGRPDLTAERFVACPFRSPGERMYRTGDLARWRSDGTLEFIGRADDQVKIRGFRIELGEVEAAVAAHPHVARAIAVVREDRPGDQRLVAYVTGSDPSGLSSAVTDTVAGRLPAYMVPSAVVVLDQIPLTPNGKVDRAALPAPGTASGTTSRAPGTAREEILCTLFADVLGLDQVGVDEDFFDLGGHSLLATRLTSRIRSALGIDLGVRALFKAPTVGRLDQLLQQQTTSLRAPLVARERTGCEPLSFAQQRLWFLHQLEGPNAAYNIPMALRLTGRLDLTALEAALTDVIARHESLRTVIAQDDSGGVWQNILPTDDTRTHLTLDTMPVDAHTLQNRVDEAARHPFDLTTEIPLRATVFRVTDDEHVLLLVLHHIAGDGWSMAPLAHDLSAAYTVRLEHHAPQLPALAVQYADYAAWQRDVLGTENNTSSQLSTQLDYWYSKLEGLPAELTLPTSRVRPAVASHACDRVEFTVPHDVHQGLTALARTQGATVFMVVQAALAALLSRLGAGTDIPIGTPIAGRTDQAMENLIGLFVNTLVLRTDVSGDPTFAELLARVRTTALDAYAHQDIPFERLVEAINPERSLTRHPLFQVMLAFNNTDRRSALDALDAMPGLHARPADVLAVTSPYDLAFSFVETPGSTEMPGILDYATDLFDRSTAEAMTERLVRLLAEIARRPELSVGDIGILSADEVKALSPEAPPAAEELHTSTLPELFEEQVAARGHAVAVVCEGEELSYKELNARANRLARVLMERGAGPERFVGVALPRGLDLIVALLAVTKTGAAYVPLDPEYPTDRLAYMVTDANPTAVVTSTDVHIPLIAPRIELDDEAIRTELAAAPDTAPCVGSGPAHPAYVIYTSGSTGRPKGVVISHANVVRLFTACSDSFDFGPDHVWTLFHSYAFDFSVWEIWGALLHGGRLVVVPFEVTRSPAEFLALLAEQQVTLLSQTPSAFHQLTEAARQEPARCAGLALRHVVFGGEALDPSRLRDWFDLPLGSRPTLVNMYGITETTVHVTVLPLEDRATSLSGSPIGRPLADLQVYVLDERLRPVPPGTVGEMYVAGAGLARGYLGRPALTAERFVADPNSRSGGRLYRTGDLAKVRPDGGLEYVGRGDRQVKIRGFRIELGEIEAALVTHAGVVQAVVLVRDEQTDDQRLVAHVVPALPHRAPTLAELHEHLAATLPAYMVPSAYRTLDELPLTANGKLDRAALAGQWQGGTRTRRLPRTPQEEILCELFADVLRLPAAGADDDFFALGGHSLLATRLLSAVRGTLGVELGIRDLFAAPTPAGLATVLAASGTALPPVTRIDRRPERLPLSFAQRRLWFLSKLEGPSATYNIPVAVRLTGALDVPALRAALGDVTARHESLRTVFPDDGGEPRQLVLPHAEPPFLTHEVTVGEVAEQAASATGYAFDITSDTPLRATLLRVSPEEHVLVVVIHHIAGDGWSMGPLVRDLVTAYRARTRGDAPEYTPLPVQYADYALWQHAVAGDEDAPDGRTARRLGYWREMLAGLPEEHTLPADRPRPVRSSHRGGRVRFELPAGVHRSLLAVARDRRATLFMVVQAALAGLLSRLGAGDDIPIGTPVAGRGDEALDDVVGFFVNTLVLRTNLAGDPSFADLVDRVRTADLDAFAHQDVPFERLVEALAPRRSLARHPLFQIWYTLTNADQDITGQALNALPGLTGDEYPLGASAAKFDLSFTFTEHRTPDGDAAGLSVLLDYSSDLYDHGTAAALGHRLTGFFAALAADPTAPLGTVPLLTDDERDRILGDWGSGTHTPLPPRSVAEQIVRRAALDPDAVAVITAEEELSYRELERLSGETARLLADRGIGRESLVAVALPRTAGLVTTLLGVLRTGAAYLPLDTGYPAERLAHVLSDARPDLVLTHAGLAGRLPAGLAPTVLVDEPQPPAAAAPAVPTSPSGDHLAYVIHTSGSTGRPKGVAIAESSLRAFLADAVRRHDLTPHDRLLAVTTVGFDIAGLELFAPLLAGAAIVLADEDAVRDPASITSLCARHHVTVVQATPSWWRAMLDGAPADAAARLEHVRILVGGEPLPADLARVLTATGAAVTNVYGPTEATIWATAAPLTAGDDRTPGIGTPLDNWRVHILDAALGPVPPGVPGEIHIAGSGLARGYLRRPDLTAERFVANPFAPGERMYRTGDLGRFRPDGTLEHLGRVDDQVKVRGFRIELGDVEAALARHPDVGRAAAAVRPDHRGQGRLVAYVVPRPGTRGPDAGELRETVRELLPDYMVPSAQVTLTTLPHTPNGKLDRAALPAPVFGTPAGRAPATREEKILAGLFADILGLPDVGADSGFFDLGGDSVLSIQLVSRARREGLHITVRDVFEHGTVGALAAALPAPADDADDTVPGTDVLPSISDDEFEEFELELGLEGEEEQW (hide)

Domain analysis:

Biosynthetic assembly:

C*TrpTCAsnTECAspTCThrTCGlyT

orf_245

Domain Start End Score
Thiolation 15 81 49.0

Detection: predicted by Prodigal
Start: 382814 | End: 383084 | Frame: -

Sequence: show MNPPEAVSTPSEVTAWITGQIAEFVNETPDRIAGDAPLTDHGLDSVSGVALCAQVEDRYGIEVDPELLWSVPTLNEFVQAMPQLADRT (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_246

Domain Start End Score
Acyl adenylating enzyme+ 19 355 322.6
Long-chain fatty acid 1 336 508.2
β-aminoalaninamide 1 336 285.0
Short-chain fatty acid 4 336 281.0
3-hydroxybutanoic acid 1 336 258.2
Cinnamic acid 1 336 233.6

Detection: predicted by Prodigal
Start: 383152 | End: 384955 | Frame: -

Sequence: show MPAVSESRCAGQGLVGALRTWARTRARETAVVLVRDTGTTDDTASVDYGQLDEWARSIAVTLRQQLAPGGRALLLLPSGPEFTAAYLGCLYAGLAAVPAPLPGGRHFERRRVAAIAADSGAGVVLTVAGETASVHDWLTETTAPATRVVAVDDRAALGDPAQWDDPGVAPDDVALIQYTSGSTGNPKGVVVTHANLLANARNLAEACELTAATPMGGWLPMYHDMGLLGTLTPALYLGTTCVLMSSTAFIKRPHLWLRTIDRFGLVWSSAPDFAYDMCLKRVTDEQIAGLDLSRWRWAGNGAEPIRAATVRAFGERFARYGLRPEALTAGYGLAEATLFVSRSQGLHTARVATALERHEFRLAVPGEAAREIVSCGPVGHFRARIVEPGGHRVLPPGQVGELVLQGAAVCAGYWQAKEETEQTFGLTLDGEDGHWLRTGDLAALHEGNLHITGRCKEALVIRGRNLYPQDIEHELRLQHPELESVGAAFTVPAAPGTPGLMVVHEVRTPVPADDHPALVSALRGTINREFGLDAQGIALVSRGTVLRTTSGKVRRGAMRDLCLRGELNIVHADKGWHAIAGTAGEDIAPTDHAPHPHPA (hide)

Domain analysis:

Biosynthetic assembly:

C10

orf_247

Domain Start End Score
A54145 ABC transporter 1 270 420.5

Detection: predicted by Prodigal
Start: 385336 | End: 386167 | Frame: -

Sequence: show MADGPGWRGGGAGIGTQFRVLTGRQFRIIYGDRRIALFSLLQPIIMLMLFSQVLGRMANPEIFPPGVRYLDYLVPALLLTTGIGSAQGGGLGLVRDMESGMMVRLRVMPVRLPLVLVARSLADLARVALQLVALLACAMGPLGYRPAGGVSGIVGATLLALLVAWSLIWVFLALAAWLRSIEVLSSIGFLVTFPLMFASSAFVPLDILPGWLRVIATVNPLTYAVEASRDLALDHSALGAALAAVGTSLALLAVTGLLAVRGLRRPPGAGPHRTP (hide)

Domain analysis:

Biosynthetic assembly:

AMR12

orf_248

Domain Start End Score
Daptomycin ABC transporter 1 269 300.8

Detection: predicted by Prodigal
Start: 386199 | End: 387159 | Frame: -

Sequence: show MGGSAIRTRQLTKHFGAVQALVGVDLEVPAGSVLGLLGHNGAGKTTLIQILSTVLPPSGGSAEVAGFDIVRDARRVRACIGVTGQFAALDEHLSGLANLVLISRLLGARPREARRRAAELVEQFGLTEAADRPMRTYSGGMRRRIDLAASLVARPSVLFLDEPTTGLDPVSRTALWETVEGLVAEGTTVLLTTQYLDEADRLADRIAVLSSGHVVTVGTAAELKAAGTRSVRLTFGSAADLESAEGALRLEGLGLTTDPVSRTVSLPLATAELAGIFRILGAAGVELAELALKEPTLDDVYLSLAESWETTSGGTVRC (hide)

Domain analysis:

Biosynthetic assembly:

AMR13