Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 18

Unknown thiotemplated cluster type
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_5006 T
orf_5007 KS
orf_5010 C
orf_5016 T
orf_5023 PPTase
orf_5024 Ala

Cluster:

      

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Error: Unable to generate predicted structure!

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_5006

Domain Start End Score
Thiolation 7 76 42.2

Detection: predicted by Prodigal
Start: 5643837 | End: 5644101 | Frame: +

Sequence: show MSVTQQSIFGFMRDQLKKTFQIPDDQIEPTTTFGELELDSLALAELAVLLGEELGVTVTEDGITAETTLAEFAGEEALVAPARAAQ (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_5007

Domain Start End Score
Ketosynthase+ 5 396 175.9
1_FabF-Bacillus-FAS_FAS_ 229.0
2_frenolicin_type2-beta_Mal 215.0
1_FabF-Streptomyces-FAS_FAS_ 213.0
1_FabB-Streptomyces-FAS_FAS_ 213.0
1_FabF-Ecoli-FAS_FAS_ 210.0
1_urdamycin_type2-alpha_Mal 209.0
1_alnumycin_type2-alpha_Mal 208.0
1_A-74528_type2-alpha_Mal 202.0
1_simocyclinone_type2-alpha_Mal 202.0
1_landomycinF_type2-alpha_Mal 201.0

Detection: predicted by Prodigal
Start: 5644097 | End: 5645408 | Frame: +

Sequence: show MTETVAVTGLGMITPAGDGAEATWERMCRGGATAATPDPALAGLEVDFSCRLPADTAFDRAVSGRAAWRLSPVTWAALTAAQDAIADAGLDLAGCDGARVAVVIGCAIGDLTLWIDQAHRLADKGPGLVSPTTMARALSNMPAGEIALALGARGPSLGTSTACASGASALVVARRLLMDGLCDIAVAGGVERAVNPLIVTAFNQMGALSSDAEPSRSSRPFAADRNGFVIAEGAGVLVLERSADAAARGARVRALLAGCGETTDAYHSTAPRPDGAGTEAAVRLALREAGLTPGDIDHVNAHATSTPVGDAAEAAMIARVLPHAPTVTAPKGVLGHTLGAAGAIEAALTVLTVERGLVPPTANADPVATPFDLDCVTGTANKTADPGRPQQLLRIRPQRRPGDPARGRPVKQSDAPSSAPARPAFTTAAACPRCP (hide)

Domain analysis:

Biosynthetic assembly:

KS

orf_5010

Domain Start End Score
Condensation+ 27 299 53.5
acv1_C2_LCL 55.1
cyclom1C5_LCL 50.1
cyclo1_C5_LCL 48.1
cdaps1_C3_LCL 43.1
cyclom1C3_LCL 42.7
cyclom1C6_LCL 42.4
cyclom1C2_LCL 42.4
compl3_C5_DCL 41.2
tioS_C2_LCL 40.4
act3_C1_DCL 40.0

Detection: predicted by Prodigal
Start: 5647321 | End: 5648251 | Frame: -

Sequence: show MTTASAKRTRDRVTVRFDGPTTGRGPATWGQTAIRRALGRLEPDDHQFNIDWGGPVEPGLPVETACDVLRGLLYVHDSLRTLLHEDGDGRYVQELHATGELDVRVADAETDDVESVAAELRHRLGGLRFDYAREWPLRVALVTRGGLVRHVVVVLSHTAVDGWGLPRLVEDITALVAGADPATLRAGRRLSGPMEEAAQQRTPSALRREASARDFVLRNLAAAPTRMYQAPGGGGYRRAVLRCPGLAEAAEACAARLRAASATVLLAAACAAVAASARRSDCVLQVMVNHRFVQRHVDVAPVHFERML (hide)

Domain analysis:

Biosynthetic assembly:

C

orf_5016

Domain Start End Score
Thiolation 8 77 35.0

Detection: predicted by Prodigal
Start: 5655256 | End: 5655517 | Frame: +

Sequence: show MNRTEIIEQVRIALSSVLNKELTELDESTRLFDDLALDSTSVIELLMGLEDSIGLEIDPDDLEPEAFGTVGTLTDYADSLAKVSA (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_5023

Domain Start End Score
Phosphopantetheinyltransferase 2 118 55.9

Detection: predicted by Prodigal
Start: 5661237 | End: 5661669 | Frame: +

Sequence: show MRLGVDLQSVSRFRGIALHRIRRILFTERELAEAEGLAVDRLVERLAGRFSAKEATCKVLGRGFGQGVRWRDIEILADRFGAPEVRLSGGAHARAHEAGLTRFQLSLTHQADFVVAVIAEEACPAPQDTRQATTPHPQGERP (hide)

Domain analysis:

Biosynthetic assembly:

PPTase

orf_5024

Domain Start End Score
Adenylation+ 23 417 272.7
Alanine 23 394 312.7
Proline 2 394 263.7
Leucine 23 394 215.8
Alanine 23 394 213.1
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 6 394 205.5
Valine 9 394 204.0
Cysteine 23 394 203.2
Alanine 5 394 196.3
Valine 23 232 109.7

Detection: predicted by Prodigal
Start: 5661665 | End: 5663186 | Frame: +

Sequence: show MTIPATTGPTATFPRGGTLPYWFARGLAHDPDAEALRIGARRHTYRELHERALALAGALVTRCGGRPRRVGLLAARSTDAYVGVLAANYAGGTVVPLNPQFPAQRTRTMAEEACIDALLVDAAGRAALGGLSDLRRHVPVVSPGDGSPLPEPLPVSPDDIAYILFTSGSTGRPKGVPVLHRNVDAYLRHVHGRYGFRPDDTFSQTFDLTFDLAMFDMFAAWGSGGTLVSVPPHAFALFRHFVNHHGITVWFSSPSAIALLRRYGALTPDAFPGLRWSLFCGEPLLERDAADWQTAAPRSHVENLYGPTELTISCSVRRWEPGSAPGASPHGIVPIGTLHSGLRCLLLDDAGQSAADTGELCVTGDQMFPGYLNSEDDRGRFVEQGGERWYRTGDLVRRLDDGTLAYLGRRDHQVKIGVRVELAEIEWGLRQCEGVEDAVVVLVGETLSAFVTGAPCEAQELRRELLGHLPPALVPRHIHRLDAFPLNANRKTDRRELTARAAALG (hide)

Domain analysis:

Biosynthetic assembly:

Ala