Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 17

Class III/IV lantipeptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf26202 LanKC
orf_4647 A

Cluster:

  

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Propeptides: 1
  • Subgraph combinations: 1
  • Total combinatorial plans: 9 (maximum 1,000)
  • Scaffolds generated: 9 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf26202

Domain Start End Score
Lantipeptide kinase/cyclase (LanKC or LanL) 23 530 613.8

Detection: potential coding sequence
Start: 5221358 | End: 5224838 | Frame: +

Sequence: show MAISLSPRTTRRNRARGPCVNPEYAAYCQADRRFYDAPHRSAGPGGGAVDEENAYYAAVRGSAPEGWTRSRRGDWLAYHPDGLRLPPQGWKIHVSAALDNAASVLGRVLAHCLEHRLAFKCIPNAGLLALRNAKYADRAGSGKFITVYPPSEEAFPEVCTALMELLEGEHGPYILSDLRCGNGPVHTRYGAFAARFCSGPDGRPVPAVADPRGRLVPDDRGPAFRVPSWVTPPGFLMPHLEARAAVGLAGLPYTVEKALHFSNGGGVYLGRDTRTGEQVVLKEARPYAGLAADGADAVARLERERAALEQLAGLDCVPDVRDVFEVGDHHFLVLQYIPGTTLNTVFARRFPLARQHPSPDLLAEHAAWAEELYGQVERAVAAVHDRGIVISDLHMSNVMVDEEAGRIVLLDFEAASPAAERRRQIVANPAFVAPPDRRGTDIDRYALACLRLALYLPLTTLFGIDRTKAAGLARDIARAFPVPEDALRPAVEEILRDVRDARDARDTGEAGEAVSRTAPGAASGTAFASPGRAPGTASGPGPGPASGTASGSASTSGRDSGEASASPADLRDWPRARDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLPGRAVDAPVDGPGHRDRRRSPRPGRRFRPPHRTSLPARRSGGAPGRHGGPTDRPRQGSWQHHRSVSNRPRKDTSWRFSTFRRWTPRPRTPSASSPRAARSRCWSVSTAPSAWSSAPRDPHRPARRCAPPTGRPATCPQGRPCRPERRPRAAVAPGPEPRHGVRHPAARPAPPGRPLLAVPLLHRRGARRPRPARRPRPHRRPARLRRARALGRAAALRRPDPRRDRVRRGGRRDRHDHHRPAHRVPAHPHRRPDPGRRAAQGPRPAHR (hide)

Domain analysis:

Biosynthetic assembly:

LanKC

orf_4647

Domain Start End Score
Lantipeptide precursor (clade B)+ 1 43 106.1
Cleaved propeptide 21 43
Sequence: TGSQVSLLVCEYSSLSVVLCTP
Lantipeptide motif A 1 25 5.59E-28

Detection: predicted by Prodigal
Start: 5224252 | End: 5224384 | Frame: +

Sequence: show MALLDLQAMDTPAEDSFGELATGSQVSLLVCEYSSLSVVLCTP (hide)

Domain analysis:

Biosynthetic assembly:

A