Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 16

Polyketide/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_4527 ThrT
orf_4529 TE
orf_4531 AmTCTCC
orf_4532 MalT
orf_4540 NR

Cluster:

orf_4527 orf_4531orf_4532 

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 1
    (maximum 500)
  • Subgraph combinations: 1
  • Total combinatorial plans: 2 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_4527

Domain Start End Score
Adenylation+ 294 677 342.9
Threonine 23 383 580.1
Threonine 84 383 497.0
Allo-threonine 116 383 430.1
Serine 23 383 423.2
Alanine 23 383 404.2
Tryptophan 23 383 391.0
Phenylalanine 23 383 389.0
Aspartate 23 383 385.9
Arginine 23 383 380.2
3-amino-butyric acid 96 383 111.0
Thiolation 791 855 31.4

Detection: predicted by Prodigal
Start: 5087957 | End: 5090537 | Frame: -

Sequence: show MPPAQHSLTVRLPSATTDTALAAAFTAAAELWWPGDRSRPRLWTESVPAPAVSDTAAGRRAAEARRPVAPGHRLRAVLLRYADERREGAAEGPDLVLTAAGSALDARSLRLVARVLRGDLAPDAVTPLDGPLPLDLRLDKETRRLASALALTVGRYAGAAAVRVAVPVPARDRPPYALGALDGYAVFAADLSPGRTVADLLATEPVAPAEDEEPPAPELVASDGIGPATLPTGPGSLPVPAHQVDHVRQQLLTFPPNTPLSRLDPLSEAESAEQLRLGVRPATPASPLRIDDAFAAQVAARPDAPALTAGSATLSYAELDCHAEVLADGLYAHGVRPGDLVGLCLPRSTDLVAAMLAVLKADAVHVPLDPEHPADRRERAARDAGVRLTVEDPALLTGHPPRPAAPRGEPGSPAYVIHTSGSTGRPKGVLVPHANVTALVDAVREDFGLSPDDTWTCFHSAAFDFSVWEIWGALLTGGRLVVVDHWTTRSPEDFHALLVRERVSVLSQTPSAFTQLAAADRVAQEAVDARLVVLGGEPLDARPLLDWFDRHPEDRCRLVNMYGITETTVHVTAATVTRRDALAGSRSVGRPLPGWSVRVLDAHGSPVPTGAPGEIVVGGAGVALGYLNRPALTAERFVPDPLDPAGRRLYRSGDLGRLLPDGTLEHLGRIDDQVKVRGFRIEPGEIRHVLLEDPAVSAAAVTVTGGDGDDAAAVRIDAYVVPAPGSDEDPGPVRERAARLLPAHMVPATVTVLPSLPLTANGKLDLAGLPAPAPASAPAPTAAPHEAGPAAALAAVWRDVLGVEAVGPDDDFWDLGGNSLYAIRIGTLARERGLPGIPLRQLYLTPTLGALSEAALEA (hide)

Domain analysis:

Biosynthetic assembly:

ThrT

orf_4529

Domain Start End Score
Thioesterase 2 117 34.7

Detection: predicted by Prodigal
Start: 5091509 | End: 5092247 | Frame: -

Sequence: show MADEDTVLICLPFAGAGPSFFTPWQKRAPEGLRVLPLSLPGREKRFPEPAYDAAAPAVDDAYAQVTAALGGADGGGGGPVVLFGHSMGAVLAYELAHRIERAGGPVRLAALVVSGAGPWTPRPDRAHGLPDEEFAARVRAFAGYDHPALADPEMRELLLPALRADVRLHETYAPSTDRPLSVPVLSVRGREDTLVGAAEAAEWGRATTGKLTVAEPAGGHMYLAERPEELLELVAAEVRATRDR (hide)

Domain analysis:

Biosynthetic assembly:

TE

orf_4531

Domain Start End Score
Aminotransferase 118 504 494.0
Condensation+ 902 1195 176.1
syrin1_C7_LCL 137.0
syrin1_C9_LCL 135.0
syrin1_C6_LCL 134.0
micro5_C1_H 133.0
cyclo1_C8_LCL 130.0
tyroc3_C2_LCL 129.0
micro3_C1_LCL 128.0
liche1_C2_LCL 127.0
bleom9_C1_LCL 127.0
cyclo1_C2_LCL 123.0
Thiolation 1338 1402 50.8
Condensation+ 1419 1516 47.3
bleom6_C1_LCL 57.4
tyroc2_C2_LCL 50.4
syrin1_C6_LCL 49.3
cyclom1C5_LCL 48.9
cdaps2_C2_LCL 48.9
cyclom1C3_LCL 48.5
cdaps1_C7_LCL 47.8
liche2_C3_LCL 47.8
syrin1_C9_LCL 47.8
cyclom1C6_LCL 47.0
Condensation+ 1535 1753 106.0
syrin1_C7_LCL 122.0
syrin1_C9_LCL 110.0
cdaps1_C7_LCL 105.0
cyclom1C3_LCL 103.0
syrin1_C6_LCL 101.0
liche1_C2_LCL 101.0
cdaps2_C2_LCL 100.0
prist2_C3_LCL 98.2
cdaps3_C2_LCL 97.4
tyroc3_C3_LCL 97.4

Detection: predicted by Prodigal
Start: 5093603 | End: 5099333 | Frame: -

Sequence: show MSAAISGSAEAVARAAELSRVLTDRIAAARAQLAAEVPADEPRPAEASAHGPRLVVDAAGGMAGAGADEAQRAHTASLIGRFTERTRTSKELAQQHRSVLADSRAVVGFRDATKEMLYPVAARSAHGSRLVDVDGNTYTDITMGFGALLLGHEAEPVTEAVRRHLADGLRFGPRSPDTGEAAALLASLTGMERVAFASSGTEANSAAIRLARAATGRDKVVMFRGSYHGHIDSVLGRPGGPGQHAVPVSRGIPDSAVAELIVLEYGEQESLETIDALGDTIAAVLVEPVQCRNPGLRPVEFVRSLRELTARRGIVLLFDEMLTGLRPHQRGSQDHFGVVPDLATYGKALGAGFPIGAVAGRADLLDGVDGGFWRYGEPGGPARETTFIGGTYMQHPLSMAAARAVLTHLAEQGPGLQSGLNDRTQALADRLNAFFRDEEFPLELEHFGSMFRFRHRADLELLYHHLQLRGVYVWEWRSFYLSTAHTEEDVNRVAEAVEGSLRELRDGGFFPRSTPRPAATVKPADAPRPAPDFGVYFFGDYPETETGESAEADGTGTPEAYDALFETVRFADEHGFSSVWLPERHFDSFGGLFPNPSVLASVVARETGRIRINAGSVVLPLHDPVRVAEEWSVVDNLSGGRVGIGCATGWHARDFALHPDRFADRRRIAFDHLDEVRRLWRGEAVRRRTGEGAEAEIRIRPRPVQEEPPFFLATSGQPASYEEAARRGLGVVTNLMGQTVEELAANIALYRRTRAACGLDPDAGRVTVLVHTYLGDDHATARADALEPMVRYLRSSLLMRSAATAAGQRREDVAAASEEDLDYLFRRAYDRYCDRRALIGTPDSVAPFVASLHGAGVDEIAALVDFGMDRERLRSGLEHLDVLRRRTRERIGAARDTRGQGRETVAPATSAQRRLWLAAQLLENPAAYNETQAVRLRGPLDVEALRAAVDGLVERHAGLRTVFRGEDEAGVVQVVREGLRIPLAVSDARGQDPDEAVAALLSEESHRAYDLAGGPLFTPRLLRLADNDHVLVLGMHHIVTDAHSAALIAGDLRELYTAALAGRPPVFARPAGTTAGAPEPPHDPADLAWWRELLGEKPPVLTLPTDRPRGRRVAGHGGAVARSVGRERADRLREWSGQQGVTLFATLCTAWQLVLRRRSGQDAFLLGTTFGRRRPETVDTVGFHVALLPLALSATDATPLPEAVRDTGRALFAAEEHSGVDLDALVAAVHPDPGNPRPLVTVSVDLDRAALAGIELPGLRAEGVAAGTESAPLELALMATHAPDGSLRLRLRYDADLFDAATADGYLAELEAQLDAVTAAPSEDAAPGRQAAAPDTATLLREIWESLLGVRGFPDDSNFFDLGGNSIAAIRLVNRVRDTLGVDYPMADFFAEATLRAMTQQLARDLGPAEEAPAEEPPVVDRAPVSDQQARMIAGHHTMPDPAVWNVPTRITFTGALDPAALRSAVSGVIARHDALRTRFVQEDAPGGPWWQEVVAAEPVPLPVQDLTGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRADALCRADAADPFELGRPLVPRPRLLRVEEDRWELMFVLHHVCADGWSLSLLLAEIAALYTAAAAGVPHGLPAPAMQAPGYARWQREHHEPGDEAERAAFCARYLDGVPSAVPVPTDRPRPQKLSGHGDTVRGVASGDVRAAVEKLAADLRTTPFAVAAAALGVFLTRLSGEEDTLLSVPYANREGTASESLVAMTSTAVMVRVRLSANLEETCAELAVRTGAGALGAMAHVLPTARIMQAMRDAGAVSVPDRVPHVLAFQNSVDTDIEIPGLRVEVTDLAPPLSRSELCFGLAPRRDAAKGYRTFLEFSTDLWDHTTAHDLLASYTDLLAEFCARPDRPVRALLAERPSLSLPNTGKADAV (hide)

Domain analysis:

Biosynthetic assembly:

AmTCTCC

orf_4532

Domain Start End Score
Acyltransferase+ 33 331 233.7
Malonyl-CoA 3 271 222.4
Malonyl-CoA 57 271 125.0
Methoxymalonyl-CoA 3 271 105.7
Ethylmalonyl-CoA 60 178 98.8
Methylmalonyl-CoA 3 214 93.9
Isobuteryl-CoA 3 188 69.2
Ethylmalonyl-CoA 4 207 67.8
Thiolation 388 455 45.4

Detection: predicted by Prodigal
Start: 5099329 | End: 5100928 | Frame: -

Sequence: show MAGLEAFLSGGPAGEAYTTGVAEGVRDPAPVFLFSGQGGGHPGMGAGLAARFPVVAEVLESCARVYAQETGRDDFLGRIVGGRGPARWDTAFAQPALFALQLAQARLWERLGVTPARVAGHSVGAYAALCVAGALDTEDAMRLVCGRGRLMQERSAPGAMVSAFVPRARVRELLAAVPGLELAVVNGATHHVLGGSPEAVDAARTLLAARGEAYEVLAVDRAFHTALLDPALEEFRLLAEKTEPHPLHTEFVDGIDGTVRPAGWRPDAAYLVAQARRTADFAAVLGELGPSPLLLELGPSAVLTGLVRRASPDAVCVPTRDWERAVAALHCAGAGVDWAALLDGCGGRRVRLPTYPFQRRSHWRGPAPYAHPSPRSTEDRMTEQAVLERVLELTARHLGHRPDEVSADRTFVGLGADSLQLIGMVRQLESEFGTEISMREVLEEAGTPRLTAALAGRAVPATVSVPVPAVAPEAAAVAAPVTDEPGYATQAEVAVLSEQIRQLAENQAAMLTQLSDAVPLLTARTTGTDAR (hide)

Domain analysis:

Biosynthetic assembly:

MalT

orf_4540

Domain Start End Score
Nitroreductase 14 174 71.8

Detection: predicted by Prodigal
Start: 5110101 | End: 5110692 | Frame: -

Sequence: show MSLVLDPAAQDLLFREARTANTFTDEPVTDEQVQAIYDLVKFGPTAFNQSPLRVVLVRSAEGRERLVQHMAEGNRPKTATAPLVAILAADNEFHEELPALLPHFPQAKDLFFSERPVRESAAGLNAALQAAYFIIGVRAAGLAAGPMTGYDAAGIQKEFLDGDHTPLMVVNIGPGEDAWFPRSPRLSFDEVVTTV (hide)

Domain analysis:

Biosynthetic assembly:

NR