Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 15

Class II lantipeptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_3919 A
orf_3921 LanM

Cluster:

  

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Propeptides: 1
  • Subgraph combinations: 1
  • Total combinatorial plans: 1000 (maximum 1,000)
  • Scaffolds generated: 50 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_3919

Domain Start End Score
Lantipeptide precursor (clade D1)+ 7 72 23.2
Cleaved propeptide 40 73
Sequence: TTWACATVTLTVTVCSPTGTLCGSCSMGTRGCC
Lantipeptide motif B 26 40 5.21E-6

Detection: predicted by Prodigal
Start: 4445107 | End: 4445329 | Frame: +

Sequence: show MNLVRAWKDPEYRATLSEAPANPAGLVELADDQLDGVAGGTTWACATVTLTVTVCSPTGTLCGSCSMGTRGCC (hide)

Domain analysis:

Biosynthetic assembly:

A

orf_3921

Domain Start End Score
Lantipeptide fused dehydratase/cyclase 14 1100 1068.3

Detection: predicted by Prodigal
Start: 4445687 | End: 4449002 | Frame: +

Sequence: show MPDDASEHPTVRPAGAHLPWRRAATLSERLAGTPSQTDPVRGEKRLAMWRELAPLTGELSTLDTRLEPLGVDTDRLTALLGEDDASLAARMADEPDWHRTFRRWWAEGMATTDATRRLDPDMGLLEVIRPLVEGAVHELDALVEEAVRASDDPVMADPGHILDIVRATAPAADLLSHVQRTLVLELNIARVEDRLVGETPEERFASYVELLRSEGNALAIWDEYPVLARLIVGQLRFWIDTRAELITALVADLPVLRETLLAARPPQRLDRLEFGAGDKHRRGRSVAMVEFDTCTLVFKPRSLAMDTAFDGLLAWVGRQNPTHDLARIGILERGDHGWVEEVDTTATTDAAGGDRYAWRLGALTALLYLLHATDFHFENVLAAGEYPVLVDLEALLHNDKTAAVVKIDGETDIAAVTLADSVQSVGILPNHLLVRGEDGTFGLDVSGLAGHGGQLTPMPVPIWEDSGTDRMRLVKRRMEMDAERNHPMTADGEPIDLVGRVDAFVEGFTHVYRLLETGRDELLAPEGPLAAFGAVRTRLIARPTHIYGRLLLESTHPDFLRDGLDHARSLARLAGGHVEMPESRNAMVLDEIAELTLGDIPMFTVDADSGTLRGGLDGEPIGTRYPPLTAVRERLAALGDADLAFQERVIRSCVAATAMGESDARWPNWHRPRMDGAADPGDFADEALRLAHRLADLCVRDAHGLGWIGLDLVDEKYWQYAPAPIGLYTGTAGIAHALDAVAAVTGDERTGELARAAFDQVAKRSVLIAETLAGLAKKPGADEFGIGAFGPFGGAIYALAHAAVRHDRPEYAEAAATLLPAIDELVEEDPLLDIVSGSAGAILALLALETARPGTGAARIAERCAERLLATRQETADGWGWATPINPEQPLAGFSHGASGIAYAFARLDRVTPRAEYREAVRHALTYERTVFDPELRTWRDLRPANLGGRTVMNAWCHGAPGIAMARNAFQELGTAPELADLIERDRHTAVLAAISTGLDLDPVSGLGNHSLCHGDIGNLLIIDAATRADQEPEVAGLLPKVWKTLLHEGRENGWLCGVPKGVETPGLMTGLAGIAWGLARKAAPERVPDLLTLAAPDTRTTC (hide)

Domain analysis:

Biosynthetic assembly:

LanM