Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 14

Lasso peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_3758 A
orf_3759 CapCCapC
orf_3761 CapB

Cluster:

   

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Propeptides: 1
  • Subgraph combinations: 1
  • Total combinatorial plans: 1 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_3758

Domain Start End Score
Lasso peptide precursor+ 5 43 45.4
Cleaved propeptide 27 43
Sequence: GYFVGSYKEYWSRRII
Lasso peptide motif 11 30 5.32E-22

Detection: predicted by Prodigal
Start: 4289836 | End: 4289968 | Frame: +

Sequence: show MKQQKQQKKAYVKPSMFQQGDFSKKTAGYFVGSYKEYWSRRII (hide)

Domain analysis:

Biosynthetic assembly:

A

orf_3759

Domain Start End Score
Lasso peptide asparagine synthase homolog 5 335 141.6
Lasso peptide asparagine synthase homolog 395 722 242.7

Detection: predicted by Prodigal
Start: 4290018 | End: 4292235 | Frame: +

Sequence: show MPGQLRDYFVVLPDSAAGAAAAGQLPVPGAAAGRSAARDATGSTREMGGALTVAHPSGRPWIVARPLVRKVSHLARGEDALVLIGPDRVPDAVLAGILEGARDRAGLERRLARLPGLYHVVARLSGRSWIRGTATGLRRIYHARHPAAGTIASDRPAVLARLIDAPLDESALALRLLDFLPHPLSRRPVWRGVHETGAGYGLALPVAAPGTAAVPGPTEHRWWEPPPGELPLAEGARKVGDAVAASVRAHVGGLDRISCELSGGLDSTALAFAARDTGPASLSLLTVAARDRYSEDETWARRAVEAAGGTPATTARNHGAAPAARNGRPAPARGHHHVSAVGLPPTPQKVSDPEALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAPALDHHPAPALDHHLIPAGDAPYFYADLASTAAELNDEPLPVAPGRARAELLLGRAHATGSRYHLTGYGGDEIFLGLPHVYQDLFHGNPFTAWSHLGGLRHQLGWPLLPTVKALLDRSAFPRWLAGAVTAAPQPVARTPLLSWGVRQSPPPWLTERATALIAEEFRAAAEQAEPIDPWRGRHVDIDGVRMGARQFQAMEDIGMTLGLPVAAPFYDDRILEATLAVRLPERISPWRYKPLLVEAMRGVVPDALLARTTKDHMASDEHQGLREHAPELAELWTGSRLAEQGLVDARHLLRLAAEPFSPVLAEHSISSTVAGETWLRTAENAPTTESAPDTTPSEASL (hide)

Domain analysis:

Biosynthetic assembly:

CapCCapC

orf_3761

Domain Start End Score
Lasso peptide transglutaminase homolog 1 140 105.7

Detection: predicted by Prodigal
Start: 4292479 | End: 4292977 | Frame: +

Sequence: show MTTEMTMPRRGAGAGGIRLRTAIAAAFVLARLKPGRLRRVLARCARGARPASYAETLEVLEAVTATSRRCASRYGCLPRSVAVALACRMSGVWPDWCAGVWATPPFSPHAWVLAEGRTVGEQAEAADLRPLMVVTVREGQGERGGGDDGGGGTGGSGPGSGQTA (hide)

Domain analysis:

Biosynthetic assembly:

CapB