Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 12

Pentangular polyphenol
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_3576 T
orf_3577 Cyc
orf_3578 KSα
orf_3579 CLF
orf_3583 Cyc
orf_3586 CmnC
orf_3594 AMR116

Cluster:

       

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Subgraph combinations: 1
  • Total combinatorial plans: 1 (maximum 1,000)
  • Scaffolds generated: 1 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_3576

Domain Start End Score
Thiolation 9 75 24.8

Detection: predicted by Prodigal
Start: 4088133 | End: 4088385 | Frame: +

Sequence: show MSVPTPVRGELTAMLAAVGLDPALGEAALSRSFEDLGLDSLARVELASRVLGGFGLDIEDDITPGATPEDVEQLQSRLSATV (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_3577

Domain Start End Score
Type II polyketide cyclase, clade 7 (tetracenomycins/pentangular polyphenols, 1st/2nd/3rd rings) 1 158 208.2

Detection: predicted by Prodigal
Start: 4088400 | End: 4089282 | Frame: +

Sequence: show MIGHTDNFIDIDAPFGFVWERTNDLRGWPELFSEYADVDILEEGPSSATFRLTMHPDEQGRVWSWVSERHWDKDARVVRARRVETGPFEFMNITWTYEEIAADRTRMRWVQDFHMKPDAPVDTAGMTERINHNSGIQLRLIKQRVERGRLRVVAMDDPSNTRRGGDLRTLLAPPNVGTSAGFCGAVRLGPGEGVSEHYHPYSEEYLFVATGEIRVDLDGEPVRVGAEQALHIPRNVRHRLTNTGAEGALVVFQIGPLAPEPHLGHVDTEPGPGESAPGIAAAHVPAESAGVR (hide)

Domain analysis:

Biosynthetic assembly:

Cyc

orf_3578

Domain Start End Score
Ketosynthase α 5 426 692.4

Detection: predicted by Prodigal
Start: 4089278 | End: 4090562 | Frame: +

Sequence: show MSAERPRRAVVTGVGVIAPGGVGREEFWQRITGGKPAIRTITAFDPARFRSRIAAECDFDPAELGLSPREIRRNDRFTQFALASAAEAVEDSGIDWGSTDRDRTGVCLGSAVGASITLEEEYVVASDHGREWEVDPSHAMPFLHQALVPSSAATELAVRFGARGPAAVVSTGCTSGIDAIGHALRLIEDGEADVMIAGASDAPITPITVACFDAIRATSPLNESPELASRPFDAERKGFVLGEGCAVLVVEELEHARARGARVYCEITGYAARANGFHMTGLRPDGFELGEAVKDVMAQARLNPEDLGYISAHGSGTQQNDRHETAAYTRALGDAARQIPISSIKSVIGHSLGAIGSIEMAACALAIDRGVVPPTANLTTPDPECYLDYTPLTARETSVPHALSVGSGFGGFQSAMVFSKNVAGEA (hide)

Domain analysis:

Biosynthetic assembly:

KSα

orf_3579

Domain Start End Score
Chain length factor (KSβ)+ 2 409 492.5
33327097_fredericamycin_12 347.0
296046089_A-74528_12 347.0
227121322_saquayamycin_9 338.0
161367424_lactonamycin_9 334.0
268322286_ravidomycin_9 332.0
88319792_Sch-47554_9 330.0
662024111_auricin_9 327.0
161367389_lactonamycin_9 325.0
29469234_kinamycin_9 323.0
32469271_medermycin_7 323.0

Detection: predicted by Prodigal
Start: 4090558 | End: 4092271 | Frame: +

Sequence: show MSARRSVITGIGVVAPTGTGVAEHWRRTLERVGRIGPIDRFGTDRLPARLAGHVVDFDETEHIDSKLRVQTDRWTWLALAAGRLALDDAALDPSAHDPFDLSVVTASASGGNHFGQREIHNLWKEGPASVTAYQSIGWFYAASSGQLSIREQLKGACGVLVAEGAGGLDALAQARRLIARGTGAVVVGGTEAPLSPYAMACHASLSTLSDDPDPDRAYRPFAPDSTGQVLGEGGAMVVVEDAGWAAERKAPPPYAEVLGTASTHDAHHPAEPAPDHRQLARAIREATARAGLTADRIDVVFADGAGDRVRDRRETDALVEVFGRRGVPVAVPKTATGRLSSGGAALDLSWAALALAHDVVPPSVNLEATDADELDLVTEARRGTGLRTALVVARGAGGFNSAAVLGLPGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASPFPGPHRRSRARNDRPGATGQETMSLRANPRNARARKNTAYEADSTRPWIMPDQAISGRRASSHAYCQCVGRNSRTEPRAVTASRIVETIISPTAPPTAPSGASVTVDSQNPTAPTTSSPPHT (hide)

Domain analysis:

Biosynthetic assembly:

CLF

orf_3583

Domain Start End Score
Type II polyketide cyclase, clade 5a (pentangular polyphenols, 4th/5th rings) 2 112 113.6

Detection: predicted by Prodigal
Start: 4100600 | End: 4100948 | Frame: -

Sequence: show MADRILIVARMAPDNAEKVAALFAASDEQSLPADLGVTRRELFRYQDDLYFHLVEFAGDADRAMAAARIREDFRQLCADLDPLIRPYDPVTWRSPADATATPFYRWTPEEGLRP (hide)

Domain analysis:

Biosynthetic assembly:

Cyc

orf_3586

Domain Start End Score
L-arginine hydroxylase 77 399 104.2

Detection: predicted by Prodigal
Start: 4102760 | End: 4103969 | Frame: -

Sequence: show MTQGRPTQGRPTETNPAPARGPLNRRLAAFGTTIFAEMSALAQRTGSINLGQGFPDTDGPEEIREAAVRALRAGHGNQYPPGPGVPELRDAVAAHQERFYGLTWSPETEVLVTTGATEAIAASLLALLEPDDEVIAFEPYYDSYAACIAMAGAKRVPLTLRAPDFRPDLDELRTLITPRTRLLLLNTPHNPTGTVLTPDELSGIAALAVEHDLLVVTDEVYEHLVFTGAHHPIAALPGMRERTVSISSSGKTFSYTGWKIGWVTGDAPLVAAVRAAKQYLTFVSGGPFQYAIAEALALPDAFFTGFREDMRRKRDLLAEGLRTAGFRVYEPEGTYFITTDISPFGDEDAYAFCRALPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKREEVLRKAVERCDM (hide)

Domain analysis:

Biosynthetic assembly:

CmnC

orf_3594

Domain Start End Score
Puromycin MFS transporter 1 487 268.1

Detection: predicted by Prodigal
Start: 4112218 | End: 4113745 | Frame: +

Sequence: show MGHAGPMAAAGSAPGEIRVASPAGRWVVLTTVLGSGMAMLDSTVINVALPRIGEDLGTDMAALQWTVNAYMLTLAGLILLGGALGDRYGRRRVFLVGVVWFAAASLLCGIAPNAGVLIAARALQGVGGALLTPGSLALIQAGFHPDDRARAVGLWSGFGGVGAAVGPFVGGWLVDGPGWRWVFLLNLPLAAICVPVALRHVPESRDPAAHGRFDVLGAVLGALALAGVTYALIEAPEQGASPVVIGAALGGLVLGAAFVLVERRRADPMLPPSIFRSRLFTSVNLVTFCVYAALGGFFFLSAIQLQVVAGYSALGAGTALLPTTVLMLLFSASAGELGRRIGPRIPLTVGPLLAAAGMLLMLRVGPDSASFGGYVTEVLPAVLVLGAGLVVVVAPLTATVLAAVDTGRAGLASGINNAAARAAGLIAVAALPLLAGMGPEAYRDAGEFATTFRRAMPMCAGLLVAGALLAWWTVRTPAATAAVRSEPECAVHCGVVAPPLEPERREG (hide)

Domain analysis:

Biosynthetic assembly:

AMR116