Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 11

FR-900098-type phosphonate/unknown thiotemplated cluster type
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf60305 DH
orf_3083 FrbJ
orf_3084 FrbI
orf_3085 FrbH
orf_3086 FrbG
orf_3087 FrbF
orf_3088 FrbE
orf_3089 PEPM
orf_3090 FrbC
orf_3091 FrbB
orf_3092 FrbA
orf_3093 Hpg
orf_3094 VlpF
orf_3095 Asn
orf_3097 TC
orf_3098 TTE

Cluster:

                

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Subgraph combinations: 1
  • Total combinatorial plans: 5 (maximum 1,000)
  • Scaffolds generated: 3 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf60305

Domain Start End Score
Dehydratase 26 54 8.2

Detection: potential coding sequence
Start: 3542571 | End: 3542739 | Frame: -

Sequence: show VGALARQVPRRSSRMRRSLWSVDGFRLLPSAGEEAAGDPASWDPRDRSALSISL (hide)

Domain analysis:

Biosynthetic assembly:

DH

orf_3083

Domain Start End Score
FR-900098 monooxygenase 1 341 769.0

Detection: predicted by Prodigal
Start: 3551701 | End: 3552727 | Frame: +

Sequence: show MTHILKEPVTGPSAWRRADVEDSSQWTYILDEKMRKEILESAEKIAANGDDVWSLSRTSVPLSRSADLFARCVDELENGRGLAMVRGVPIEGLSLEEAHTVFGVVGLHLGKAVPQNGRGDRVVSIKDHGIGRLNSKTVRGYQTNEALPFHSDAPDIAALLCLQQAQQGGEFYVASAMQIYNTLLEEAPELLGLYYAGIFYDYRGEEPPGEPPAYKNAIFGYHNNQLTCRYFLRQFADSAPAKLGFFQSEAEKLALDTFEEIAAREENYVSMRLAPGDMQLVDDNITVHRRAAYSDEADGATDTTRHLLRLWINVENGREFPQFVSTHRWGMKRAATVQQK (hide)

Domain analysis:

Biosynthetic assembly:

FrbJ

orf_3084

Domain Start End Score
CMP-5'-3-aminopropylphosphonate NUDIX hydrolase 1 191 417.0

Detection: predicted by Prodigal
Start: 3552788 | End: 3553364 | Frame: -

Sequence: show MTAPNESVELRRWIGHDERVVHRSRWLTHYAARVKLPDGTRVDHHFVRTPAAAIVLAVDDEDQVLLMWRHRFVPDLWGWELPGGLVDEGEDPAVTAVRELEEETGFRASAVEPLLVYQPMAGMADSPHHLFLARGLCFTGEAADRTEAERTAWMSAEECAGVLGAGRILTSGTAVGLLSFLARRGVGLPA (hide)

Domain analysis:

Biosynthetic assembly:

FrbI

orf_3085

Domain Start End Score
2-amino-4-phosphonobutyrate cytidylyltransferase/decarboxylase 56 610 1255.8

Detection: predicted by Prodigal
Start: 3553360 | End: 3555193 | Frame: -

Sequence: show MTKVALPARAIVLAAGLGQRLGQSSAVQPKPLTPVAGRPILEHTLGHLANAGVREVVLVVGHLHEMVRESTGDTYAGMRIHYVLNEHPDSTNNLHSVWLARDYLDQDVLLFEGDVVFEAEVLARLGAFDGNAVAAAEPVRPLRGTVVEHDDEHRLVRYIDDRGQSGAFDHPDSLKTANLYLLRRPFLRERFLPALDDLNGRLSGQGYYDYAITAGLADGGHPWFVADITDLAWYEVDDPGDRRQAEFRLLSPPDQKRFLETLHGGYWRYGVKDHALLYNVHFPPAGMMEILQSDFDAVFRNYPSSHTPLTELAATVARRAPDEVVLANGSSELIKILARLRGNWAVPVPGFNEYENVVGTDRVKRFPLSGADFALPVEEYAAFVRESGVDTAVVVSPNNPTSAGVPLEELRTLARLVGPDVMLVVDESFVDFAPAPVGSLVPYLEEHPNVLVLKSISKVYGVGGIRLGYAVTADTEWAAVLRRELPIWDINGFAEEFLRVLPHFRSEFAESCVRMRDNTLALADGLAALPGVRVVPPDANFVFVELSGPVDAPTLSLELFRRHHILTKECSGKSMPGGDRYLRVSSRTMEENKVLVGAVAEILAEGRGG (hide)

Domain analysis:

Biosynthetic assembly:

FrbH

orf_3086

Domain Start End Score
CMP-5'-3-aminopropylphosphonate N-monooxygenase 5 440 693.9

Detection: predicted by Prodigal
Start: 3555242 | End: 3556565 | Frame: -

Sequence: show MSAAARYGTIVCGGGPAGVSTIVAAAVQGRLDELLDDGVLLIESTESAGAGAFAGYTIRANSLGSAFLECLEGRAGKELLAGLEHTPEAEALRARADEYPPLPAVAPFLALVGRRVVEALRAHPRCDAILGHEVREVQVAPDGVRVRFTAPGGAPREAVGERALIAMGGRERVEVPGRAVARLAAARPGLAVLPSAEAIGGPLLSAGAVDSPYRDVRRVSVLGGAHSAWAVAAQLAVLARDGWFRHDVAVRVLERRDPPIFYSSEEEARADGYAFASDRDVCPLSGRVHRFAGLRGPARELARRILDLDAEAAPAGFDSRTVPGPWTADSLAAAVPADTGLLITALGYDARLPRLTESQDATPLRLARRAGAVDSGADATPLLESGAPVRRLVTYGLGAGLVPHDGIGGEPGYTGRLDGLWIYQHDVGAVVLDTLLSTR (hide)

Domain analysis:

Biosynthetic assembly:

FrbG

orf_3087

Domain Start End Score
CMP-5' -N-hydroxy-3-aminopropylphosphonate N-monooxygenase 1 277 578.2

Detection: predicted by Prodigal
Start: 3556561 | End: 3557398 | Frame: -

Sequence: show MEPLTPAREPITRARLRTDLAALGVEQGQVLLVHASLSSLGWVCGGAQAAVLALQDAVGPEGTLVMPAFSGDQSDPATWRSPAVPESWWPVVRAHMPVFDPALTPTRGMGAIAECFRRARGAVRSGHPQNSFAAWGRHAERITRDHGLDQRLGDGSPLEHVYDLGGSVLLLGCGFESNTSFHLAEYRTPYPGRRLTTRVVPIPREGRNEWRKQDDIAYYEEDFHKMGESCLARVAGHTRGKVGEADAVLYPQRPFVDAACDWLHANRDLTPSTAGAS (hide)

Domain analysis:

Biosynthetic assembly:

FrbF

orf_3088

Domain Start End Score
Isophosphonomethylmalate dehydrogenase 1 370 722.2

Detection: predicted by Prodigal
Start: 3557432 | End: 3558551 | Frame: -

Sequence: show MRTYEVTLVPGDGSGPELVDAARSVLDHAARLSGFKIDWDVHQAGQRALAESESLLPDATLNSIRTNGAALKGPTTTPIGTGHRSVNITIRQELDLYACLRPVRSLPIASTQEEPERPHVDLVVVRENTEDVYAGLEYPKGSPGARAVVQALGALGRPLPADTAVSLKPFTPHGCERVVEFAFNHAARHGRKLVESVCDARRYPATEGMFARVASKVAARHPSIASRTVPVPALCADLVRAPGRHDVLVLPNLYGDIISDVTAALVGSLGVAPGANIGAHHAVFEATHGSAPEFAGSGRLNPTALIFSGCMLLDHLGEHETAARIRAAVEDVVAAGEVLTFDLLAPQRSADAATTVEFTRAVTDRLGPVRP (hide)

Domain analysis:

Biosynthetic assembly:

FrbE

orf_3089

Domain Start End Score
Phosphoenolpyruvate mutase 1 276 385.7

Detection: predicted by Prodigal
Start: 3558558 | End: 3559389 | Frame: -

Sequence: show MNKRSMLRNAISRDGFSIAAGVHDGLSARIAESGGFDVLWASGLGISASYAVPDDSILTMTEFLNAARAMNDATELPVLADCDTGFGDTRNVARMIDQYERAGVAGVCIEDKVFPKRNSLGDGSQDQETVEGFCAKLEAAKKAQSTSDFVVVARIETFIAGGDRADAVRRADAYVGAGADAILIHSKSKDGAEILDFGRTWENKHTPLLAVPTTYPQVDAEQLKAAGFSLAIYANQALRASITAMQKSLIHISQHGSTVGLESDIAAVSDVFQLQ (hide)

Domain analysis:

Biosynthetic assembly:

PEPM

orf_3090

Domain Start End Score
Phosphonopyruvate C-acetyltransferase 1 376 699.4

Detection: predicted by Prodigal
Start: 3559691 | End: 3560831 | Frame: +

Sequence: show MTMRDDIILEDTTLRDGEQTPGVAFSKETKTKILNSLIEAGVTSVEIGIPAMGGEELDFIKSCVDRQDEARLVVWHRGVREDVESSLDLGFKAVHIGLPTSKGHLKASVRKDRSWLLSTATELIKMAKDRGAFVSISAEDIARTEISFLQEYAGVVHEAGADRLRLSDTVGLLGPEAYGERVAAVGEAAPIDTQCHAHNDFGLATANTLAGLHAGARYFHVTVNAIGERAGMADLAQVVVALKKLYDRDLGIDLTKLKDMSRIVAAAANHEVLPWQPVTGDNVFAHESGIHANGMFRDTSSFEPFPPEHVGGERRYVLGKHSGRALVAWALEQQGIEPREDLLGQVLDEVRAESIRARGAVSQEETVALYEKALATSG (hide)

Domain analysis:

Biosynthetic assembly:

FrbC

orf_3091

Domain Start End Score
Isophosphonomethylmalate dehydrogenase 1 349 682.5

Detection: predicted by Prodigal
Start: 3560871 | End: 3561921 | Frame: -

Sequence: show MGRHPRVAWWEPRDTLGSEVAEASRELFEAAGMAVQWVRTVPGEAAEDQVEAGLLAPLGAVDDDTHHQERQVRAAWGGVLTVIERTGTAIRSGLPVSVLLLRMESGLSNSGIELWPDSEGQRVLLEATAAQEGRTLSEYAAVAVHAIDPDHIRVLCREAFEVCCERSVQRITVTHKGNSIKYTDGLFAVVAKQELEKLIGDSGIIQESLIIDHMAAELTRNPQDYRAILTHGAFAELLAALLDGQLDTDAGGVCRTIGTARRPLFGYDVALDPARHTRAPEAEAAGRLRSVLLAGSLLADHLDQGVAAAGIRAAADALDAPATADGHAGTAGLAACARTAHHAVRTAV (hide)

Domain analysis:

Biosynthetic assembly:

FrbB

orf_3092

Domain Start End Score
Phosphonomethylmalate isomerase 1 880 1750.8

Detection: predicted by Prodigal
Start: 3561991 | End: 3564634 | Frame: +

Sequence: show MKNLLRSVNLPDGNIRFISLAAAEENGLSGLSTAPRSIRVLVENILRSSFSATSGDVAAEAENSLSAAEALISASSGDGPVAEVSFRPTRLILQDHSGIPVLADMASLRSLMAERGLDPRAARPALPVDLVVDHSVEVASWARPDALRLNMGREYHLNGERYRFLRWAQQEVDGLRVVPPGKGIVHQMHLEHLARVVMPDATGLLSPDTVLGTDSHTPMVGALGVLGWGVGGIEAETALLGHPVSLLSPLVTGVRLTGALPVGSTATDLALTMTEFLRRTGVVGQFVEFFGPGAAALEVPDRATLANMAPEYGCTVAFFPVDEKTLAYLRLTGRPAEEIARIEAYTREQGLFVPLGSTAEPHCARVVEFDLSAVVPVVAGPRRPQDRLPLVEVPASFPQPREAAPGARGPVDGAIGIAAITSCTNTSNPVSMVTAGLVARRAVERGLKVPDWVKTSLAPGSRTVVHYLDAAGLLPSLEKLGFSVAGFGCTTCIGNSGDLSPVAAEAVRAEKVRFSAVLSGNRNFEGRIHPDVAAAYLASPALVVAFALAGTVLTDLTEASLGTDQDGSEVRLADLWPAAHEVAEALASVRREHFGQEKDSLFEGDEQWRSLDFPSGAVYDWSAGSDYLVRSPFFDEDSRRELTDLTGARVLVRAGDSTTTDHISPAGAIAVDSPAGRLLSGLGIPAAEFNSYGCRRGNHEVLVRGTFANPKFRNRLTPDVPGSNTVHLPTGKVTSIHEAAAAYAAEGIPVVVLAGKDYGFGSSRDWAAKGPALLGVRAVLAESFERIHRSNLVGMGIVPLQFLDGDSADSLGLTGHEAIDIVGLGALEPRGEVVARAHDDTGAVVREWTMRVRVDTAGELDYVRRGGFMHAVADTLLAG (hide)

Domain analysis:

Biosynthetic assembly:

FrbA

orf_3093

Domain Start End Score
Adenylation+ 8 391 253.0
Hydroxyphenylglycine 22 383 200.7
Histidine 14 383 194.5
Lysine 75 383 187.5
Leucine 22 383 185.7
Valine 8 383 185.3
Serine 9 383 184.5
Alanine 5 383 184.3
Glycine 77 298 180.4
Ornithine 22 299 108.7

Detection: predicted by Prodigal
Start: 3564657 | End: 3566139 | Frame: +

Sequence: show MTTIWDVVAERAAADPSAVAISDRSDITYGELVERATALADAVGARAAPGSLLAVDASGGTAGVVALLAGARVRCAVLPLNLEQPPLRRARLMAEARPSLVLTEADDYGFTVAEPGAEAVPEPREPSLQDVAYVLYTSGSTGRPKGVAVPHRSLTERIAALARVPGLAAGESMVSMTALSFDISLAELLVPLSVGGRFITAPPMARLDPDAFIRFSKDHPADVVQATPSFWRLALKGGWQGSSALRVWCGGEALTPSLAGRLRPLCRELWNLYGPTEATIWATAARIDDADAVSLGEPLPGTSVCLARPTEADSTPAGLVTEPGEEGEILLYGAGLALGYLDRDDLTEKAFVTHDTPDGPRRVYRTGDRGRYRADGGLEFLGRADAQVKLGHRLELGSVEAALEEHPTIGQAAVVLRDTERPEHTYMEAFMVAADTLEQRELRTWLRGRLPASEHPRRFTFVTELPRTTAGKVDRVKLAQWSGEPGTDKEPA (hide)

Domain analysis:

Biosynthetic assembly:

Hpg

orf_3094

Domain Start End Score
ATP-grasp amino acid ligase (Val) 18 417 336.1

Detection: predicted by Prodigal
Start: 3566135 | End: 3567398 | Frame: +

Sequence: show MSTAPPGIEQEGQDGVDGHLLLIGWRNQAVPAVNALGCRVTWVVTPGEAAQVRDEGFTQDLVLVADPTNPEQILAGLARSGYTLAGFTAVGSDLEFTLVAASVVGELAGARCLPVRTAVLLRDKVAQKNALRAAGLPVADTLAIGDLGELAEPPMSPPFVVKPPLGAGTTDTWVLRDEAEIAALLGSRGRDTAGPWAVESFVTGHEVQIDGVVRGGRVVRLAVSRYLQNLILIREGAVNASVVLDPDRYAVMYERAHELVARSLEILEHRDGVFHMEAFDQGDRLVFSECGGRTGGALTRQQLGRQFGLDLMDEWARSLVGLPAGVLDEYRSEHVYGYTLLLPPEGRIEHVPDLKEVLGRPGVVEGSVSLKKGDVWGRLLHSSQRAGRVLVRGADEEELVTRLHDIGEWFRSAVVVPVP (hide)

Domain analysis:

Biosynthetic assembly:

VlpF

orf_3095

Domain Start End Score
Adenylation+ 76 477 342.3
Asparagine 23 401 627.0
Aspartate 23 401 554.5
Glutamate 23 401 443.2
Phenylalanine 23 401 430.0
Methyl-glutamate 23 401 408.4
β-hydroxy-asparagine 1 401 397.7
Leucine 23 401 385.7
Alanine 23 401 379.2
β-hydroxy-aspartic acid 1 401 368.3
Histidine 12 228 108.5

Detection: predicted by Prodigal
Start: 3567458 | End: 3569216 | Frame: -

Sequence: show MPSPLTTEATFLVLVNTAGARCLWPADASVPAGWSTELDRASRQDCLDFVERAQPHPQPVATPAPAPGPEPVPTLFEQIAARHPERIAVSDAGVRLTYRELNTRANRLARLLLTRGAGPETRVGVLLPRGHEAVTAILAVLKTGACYVPLDPDYPAERVRYMVEDASPVCVVSRDGVDTGGLDAPALRIPSAAAEEPGADPAGAADLRDEERTAPLTADCAAYVIYTSGSTGRPKGVVIEHRSLLHYVGWAADAYPGARTSTLLHSSLSFDLTVTALYVPLLHGGCVHVAALADDPDVRARLDEEPLGFLKVTPSHLAVLPLLPPQFWPSGELVVGGEQLTGSMLRQWRALAPHVTVVNEYGPTEATVGCLEHRVKPGRELADGPVPIGRAVPGVRIRVLDGALRETAPGEEGEICVSGVGLARGYLRRPGVTAERFVADPYGGDGARMYRTGDRGRRDADGTVEFLGRLDDQVKVGFRIEPGEIEAVLSTHPGVAQVAVVALRGRRGTSRLVAYAVPDGEGAPPTPAALRARAATVLPDHMVPAAYLVLDAFPLTPNGKLDRAALPAPDFRRDPGIAGLPVHG (hide)

Domain analysis:

Biosynthetic assembly:

Asn

orf_3097

Domain Start End Score
Thiolation 16 80 25.0
Condensation+ 108 393 112.2
bleom6_C1_LCL 86.7
cyclo1_C9_LCL 80.1
cyclo1_C7_LCL 77.8
cyclo1_C8_LCL 77.8
cyclo1_C11_LCL 74.7
cyclo1_C1_LCL 73.2
cyclo1_C10_LCL 72.8
cyclo1_C2_LCL 72.0
grami2_C4_LCL 69.3
micro5_C1_H 68.2

Detection: predicted by Prodigal
Start: 3570589 | End: 3572197 | Frame: -

Sequence: show MQSTQWSDSAAGEMLTLVLESFGEVLDDDDIPDDVAFTVLGGSSLDGSVACALLGSALGFSVPLSLLAANPTAREFAGALALLGERSERAGLDMGQSGSGRENEGKSPEESVPLTEAQIGFLTQQLIDASDRSAHLQFAWVLTGPLDMEALRGALHDVHQRHEPLGSRYLIQRRDAVARPHTTDMVTLTCLPDAGSEQSAIDATRDALDGDLDLSAGQVWRVALARVKDRDVHVLRVMAHHIAFDGMSEAVLVKDLGAFYAVRRDGAKAALGPVAGMSERARARERHQRLNAANLDRQRAYWATELADTPPLVFPGEGPMAPATPGTLLVCRTTVLPAGWLDEVDALAARHRTTRFAVLLTLYDRVLAESSGSAVHGVGFPVARRWDGLSAGIDCCMDTLCLRMPADTRYGVRDFADAVRATTDRLTAAFAAADVAFADIVRAVNPRRGSRAPLYQNMLALQDYDRPGLALAGTESRRLDEPYLGLPSELHVEIVPHPDGAARVAVSHRPDAVPERFAASFHTALAARLHSLPA (hide)

Domain analysis:

Biosynthetic assembly:

TC

orf_3098

Domain Start End Score
Thiolation 15 77 38.5
Thioesterase 90 226 83.3

Detection: predicted by Prodigal
Start: 3572507 | End: 3573596 | Frame: +

Sequence: show MANQVDENSSQVIAEELKVLWEDLLGAAVQPSDDFFDIGGYSFLAVQMVNELRESGHRLSASDVYEHPTLEGLASHLAGGQASAEHPEPAFSALWSEAVSPWSGERPKALVQLALGEREPFFWVHWGTGNIGYLRPLADRISGGRPVYGFQHPALVRRERVEMSVGELAEGYLTELLEVQPEGPYLLGGLCNGSNIALEMARRLTERGREVALLAFVNGYPNSIPDIDPGDGPEEFYQLRLATLRQRFEVENLAAAAPEVMKQLQAEDVAYYDEHEKSGDLMWFQAVWAAIAFAHRHHDPRPFAGRTLVFQTKKGEPSFTSHWKALVPNSQAETFDVRSTLPILQHGPFQESITRHLSQNF (hide)

Domain analysis:

Biosynthetic assembly:

TTE