Your browser does not support SVG

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

Isonitrile

Lincoside

NRPS-independent siderophore

Nucleoside

Phosphonate

Regulatory

RiPP

Nonribosomal peptide

Polyketide

Type II polyketide

Other

Cluster 10

Pacidamycin-type nucleoside/nonribosomal peptide
From search #20190318-1629-590782499
Sequence: DS999644.1.fasta

Biosynthetic assembly:

orf_2904 T
orf_2905 Pac9
orf_2907 Pac11
orf_2908 HpgT
orf_2909 Pac13
orf_2910 C
orf_2911 DapT
orf_2918 Pro
orf_2922 E
orf_2923 Pac5
orf_2927 Met

Cluster:

   orf_2908  orf_2911    

Legend:

Aminocoumarin

Aminoglycoside

Antimetabolite

Beta-lactam

Bisindole

Cyclodipeptide

CDPS active site

Deoxysugar

Isonitrile

Lincoside

Siderophore

Nucleoside

Phosphonate

Regulatory

Resistance

RiPP

Cleaved propeptide

Nonribosomal peptide

Polyketide

Hybrid

Type II polyketide

Tailoring

Bacteriocin

Other

Predicted cluster product:

Combinatorial structure library: TXT or open in browser

GNP library: TXT

Combinatorial data evaluated:

  • Open reading frame permutations: 2
    (maximum 500)
  • Subgraph combinations: 2
  • Total combinatorial plans: 6 (maximum 1,000)
  • Scaffolds generated: 2 (maximum 50)

Downloads:

Genomic cluster sequence: FASTA
Biosynthetic open reading frames: FASTA
All cluster open reading frames: FASTA
JSON report: JSON

Analysis

orf_2904

Domain Start End Score
Thiolation 13 77 44.3

Detection: predicted by Prodigal
Start: 3357863 | End: 3358148 | Frame: +

Sequence: show MSLQNAKAPERVAVLTRIWREVLGDPALDEDADLFEKNGSSLQVLQITGRIHDALGIDVKLRHVFSYASPRSLSDFDAEFAQGDSGAVHGGEK (hide)

Domain analysis:

Biosynthetic assembly:

T

orf_2905

Domain Start End Score
Pacidamycin peptide releasing condensation domain and nucleotidylyltransferase 1 423 863.3

Detection: predicted by Prodigal
Start: 3358144 | End: 3359419 | Frame: +

Sequence: show MTASGSRAAQGPTSLAEMARLTGEFADWHNLHYMAMWLTGELDVAALRDAWWRVCLRHDALRRTYLSPEEARTDGDALSEVEFLTAASDADAVELMSRFIGRPFDLGGPSFSRVAVVRCGERRHLFGIAIDHIINDLASWALIRADFTEFYRRALTGDSGDVTAAGSYQSFASEERRLFAGRWGQECRAFWRSYVDEFGTVPAPFPVGGDTTGAYRPRTISRVLPADAKARLHALSLEARATPFAAVTAGVLAAAKEVTGDPVAGISVNQHGRMLPGTSQTAGLFVQTVPLHLGAPHKSPAEAVREVFHRTHDVFEYSVPLLVAGRYWSETLMVPDRQAGLYVSLNEEPPSSHDLPPFAGTEAEYVELDVPGGKRFPETVVVAWNLYETGPELVAHYNEDRFPGEAVEQLLEAAERFVLPADQ (hide)

Domain analysis:

Biosynthetic assembly:

Pac9

orf_2907

Domain Start End Score
Uridine oxidoreductase 1 443 968.2

Detection: predicted by Prodigal
Start: 3359648 | End: 3360980 | Frame: +

Sequence: show MNAFTGAFWRSGDPGFADAATARVFNRRLPSRRPAAVLRAADVADVAEGVRLAAAEGWRVAVRSGGHSWAAWSLREDTLLIDLALFTGMSYDPTDATVTVGPAVRGGLDLDPYLAGHGRFFPVGHSPSVGMGGFLLQGGIGWNCRGWGWAAESLVSMEVVTAAGEVVRCSETENADLFWAARGSGPGFFGVVTAFRLRTRPRFRELTRSAYVFPSELAAEVLSWYHVARHDLPASVELAAVGCTPPGSDAPVLTVDAVSFDGGPASLAALDSCPVVARASARTVAEPVDFAELQAEQLRGNPENHRYAADNAFLSGSASELVPALVPAFTELPTPRTFTVLGDFTPLVARRPPDMAVSLQTDLYFAAYAIGTTPADDVLSRAWLDRTMSRLEPHSAGCYLGDSDLAVRADRIMSDAAWSTFRRIRAARDPEGRFPGYLGDPA (hide)

Domain analysis:

Biosynthetic assembly:

Pac11

orf_2908

Domain Start End Score
Adenylation+ 278 673 315.6
Hydroxyphenylglycine 23 395 494.3
Valine 23 395 443.2
Phenylalanine 23 395 364.6
Alanine 24 395 362.7
3,5-dihydroxyphenylglycine 23 395 361.8
Leucine 23 395 361.4
Tryptophan 23 395 361.2
Aspartate 23 395 350.6
Cysteine 23 395 346.5
α-ketoisocaproate 4 395 110.6
Thiolation 781 845 62.6

Detection: predicted by Prodigal
Start: 3361008 | End: 3363546 | Frame: -

Sequence: show MTTDHAALPTGCHARTPAPPPDAASLPDDPPLPYEIALPTDRSRPAHPAPVVELHRFDLTPEIHRALLATAEAARASLPTALHAAVAALLTRLGAGVDIPIAAPADSPARYLSLRIGTDGDPSLRELLVRAREAGRTARARQDVATRRRTDDADSVRRVESGPAAQVAVLVVDEHGPGSDPTGTTGFDLALTTTERRGAEGEPAGIACALAYDSELFDPETAAALAARLVTLLTAFADVPDTALSRVELFSDDERRAWLAMSSGTERAIGECTLVELFETRARAMPDAVALVCGDRSLTFAELNERANALARRLIEAGVRSEEPVALLMDRSAEQIVAILAILKAGGCYLPLHLAHPARRMTGALAAAEARILLTDGSHADHEVARAAGTTLLVTADGPAAADGGDLDRKPLPEQAAYIMFTSGSTGTPKGILVPHRSVVHLALDRCWGEGVLERMLVHFSAAVDPSTGEIWAPLLRNGSLVIAPPGDLDAQELRELVSRHGVTGAIFPGGLFRMLADDDPAAFAGLTGVYTGGEVISPVAVRKVLDAAPGLLVHPLYGPTEATLAVTYHTIRRAGELAGDVPLGRPMDNRRVYVLDEHLNPVPPGTVGELYLGGEGLARSYVGSPVLTAERFLPDPFQGVGARMYRSGDLARWTRDGVLMFVGRADEQVKVRGYRIELGEIETALARQEGVRRVAVVVREDQPGDERLVAYLVPDAGAAPDPETLAEELRATLPAYMVPSAFVALPELTLTPNGKTDRTALPAPDYGGGAGQGPRTADEERLCALFAEVLGVERVGVDEGFFALGGDSLLATRLRTRIRSALGVDLRARVLFRHPTVAELARL (hide)

Domain analysis:

Biosynthetic assembly:

HpgT

orf_2909

Domain Start End Score
Aldo-uridine dehydratase 1 121 247.4

Detection: predicted by Prodigal
Start: 3363583 | End: 3363949 | Frame: -

Sequence: show MTTYRHTVEDADVFSKHGIELTVYGQRDPSATVVRVQVERGHFQEFSNSRSSYSYYIVSGSGVFHLNDEAIAVGATDLVTAPPNTRIHYFGTMEMVLTVAPAFDERDERHIRFISESEIP (hide)

Domain analysis:

Biosynthetic assembly:

Pac13

orf_2910

Domain Start End Score
Condensation+ 1 299 174.1
micro5_C1_H 131.0
fengy4_C2_LCL 117.0
syrin1_C9_LCL 114.0
syrin1_C7_LCL 108.0
bleom6_C1_LCL 108.0
syrin1_C5_LCL 107.0
ituri1_C3_LCL 106.0
liche1_C3_LCL 103.0
micro2_C1_DCL 103.0
bacit2_C2_LCL 101.0

Detection: predicted by Prodigal
Start: 3363952 | End: 3365623 | Frame: -

Sequence: show MFPLSAAQQIVWLQQQVLPESRAYHATAVIEFHGEFDPVVIRRCIADAVGRHDAFRIRMCDTDSGIPVQEVVAHISVEVSQYDLRDADDPAGRREELLRGQVTTAFDLRTAPLVRWMLLHLADGHWQLVMTEHHLVHDGRSTVIFLGDVLDQYAAEMSGGHHVPQAAPSYEEYVAYTGSDEYRARVAADVAWWAERLDGARFSVDFPTLGTRRSALFDHRGGQFRQVLPAALMDQVRDVAQESGHTVFATLLAVYSELCRRHSGQNELVIGMPLANRPVEFEHTVGMMVGAVPLRLAIPLAPGSDLAEEAMTAVFDAIDHESAPIQDLVTALKRSSKGLGNPLFNIMFAMHDAPCPPVKIPGLSANMEIAVSAGSTKFDLSVVVMPDKVLQADHGDHGYELVWEYSTQMFGPEDVETLATGFETLLRAYVARPSAPIGTLAPAVAARPARDARNKDEEFGAADAAEVAPRAGEAPATDAGTPSGSLWLQAFRHILERDDIDEDTDFFQAGGYSLLVPLLVAHYETLAGRRTPTSLVFEFSLPRELEAATAAMAGR (hide)

Domain analysis:

Biosynthetic assembly:

C

orf_2911

Domain Start End Score
Adenylation+ 31 430 309.6
2,3-diaminopropionate 2 399 392.3
2,4-diamino-butyric acid 23 399 326.0
Phenylalanine 23 399 318.8
Serine 23 399 317.7
Tryptophan 23 399 317.3
Tyrosine 23 399 302.4
Modified tyrosine 7 399 296.9
Leucine 23 399 291.3
Hydroxyphenylglycine 23 399 291.2
3-aminonon-5-enoic acid 4 399 110.5
Thiolation 536 598 36.1

Detection: predicted by Prodigal
Start: 3365876 | End: 3368450 | Frame: +

Sequence: show MTEKAEAVRGRQAHGVGPVRPLPDRRAHEIFEECARATPSAIAAVHRGTRWTYAELDAAANRVAGALLSAGLRPEGVVSVISHRSLDWLAAMLGIFKAGGAYLPIDPAYPDERIADLLHRSGSRLALVEDDVSERPLKEAAVRALPLAPAAAVEAQPAATVARVGDGALAYIYFTSGSTGAPKGAACEHAGMLNHLLAKIDTFEIAAGTAVAQTASQCFDISLWQALAPLLVGGSTVIIDPELMLDVPALLALLAAENVGVLQLVPSYLDVIVSRLERGDRAPDSLRMLGVTGEAVSPQVLTRWFKQCPDVPVVNAYGATEASDDTTHEVIRGMADDEQVTVGVPIANVLVDVVGEDGLPVADDSVGEITFSGVCVGRGYINDPERTAEAFGDDPVRPGLRRYRTGDYGHWLSDGRLRFVGRRDEQVKISGVRVEVGEVEAQLLRVAGVRAACVIVMPDGASKRLAGFYTAEQAIPTVRELLADRLPTQLVPRTLRWLPEFPLTDNGKVDKRALAELETSSASGNSVTPPRTAAERRIATVWAEVLGLPLDEVGRNDDFFAHGGGSLAAVRLVVQLGGLISLVDLMANPVLADLAAAEGAGPAEAPLLQPLSVPKGATAALVCVPYEAGNALNFGAMARALSAADVAVYAVELPGHDFARPDEELAGVDRVAGPLTREILDRIELPVALWGHGAGVALALETARSLREAGAPPRHLFLAAAIEREPADGGPAGGGTAAAGSTDIGAWLRDAGALTDVDQSRSSRGELIERAYRHDLREAERYLSDFSGTLDLPTTIVAIPAAPGEGEATARCADVLPGARITRFAEPSRYLVRSHPAAAAEIVTATLAAAEEGSTR (hide)

Domain analysis:

Biosynthetic assembly:

DapT

orf_2918

Domain Start End Score
Adenylation+ 10 413 233.3
Proline 2 403 222.6
Valine 8 403 187.1
2,3-diaminopropionate 8 403 183.8
Alanine 5 403 178.7
Tyrosine 10 403 171.6
(2S,6R)-diamino-(5R,7)-dihydroxy-heptanoic acid 5 403 169.8
Proline 5 403 166.3
Histidine 14 403 164.5
Glycine 43 324 110.5

Detection: predicted by Prodigal
Start: 3375834 | End: 3377358 | Frame: -

Sequence: show MALTLVERFLRGLEISANRSALRVGSEDVTYQQVHDTALIWAGALRANGSPGPVGVLTGKSVTTYVGLLAVLYAGGTVVPLQPSFPAALTRRMMKTAGVGEVIADERGLAVLPEVVRDDMTVRVLDNGGSATGFPLIPVSAESALAEPVEVELADPAYILFTSGSTGIPKAVPIAHRGFAHYFDEMDRRLDFGPDDVLSQTFDLNFDPGIHDVFAAWGAGATLQAVPPSAYRDLPGFVAEHGITVWHSTPSGIWMAREMGALAKGALDGLRWSFFGGEALRCQDVLDWLVAAPGSKVENLYGPTEFSIGVCWHRWAGEESQRRGVNGTVPIGKVHAVNDFRLVTEGGEQSAVEGELWLTGPQISTGYLDPAENEGRFVVADGRRWYRTGDRVRAQPDGELAYLGRMDSQVKIAWRVELAEVDHVVRACAGVLDAVTVTRSAAHGEELVVFYTGDEVPDQELADGVGAVLPDTVLPRQYVHLESLPLNPNRKVDRLALRKRAEELAG (hide)

Domain analysis:

Biosynthetic assembly:

Pro

orf_2922

Domain Start End Score
Epimerization+ 1 205 33.0
surfa4_C4E 39.3

Detection: predicted by Prodigal
Start: 3381521 | End: 3382718 | Frame: +

Sequence: show MTDRLPLSSAQLAFGLDAQRSGRRGTVTMMFRTPSARLVTEDVRQVLESVLLSNPALSHRIQFSRGTAYQEWNPSECHVTELRALDAEAVAESVERVVEEFEASLDGASMTACLIRSPTGDHLLLVLDHALVDEHSVRLIKRQLAAPSAPDEHRMERYRNAVFDRVKSETEAADGPGIKFWTERLESAGEFQRPSARTTRAIPVTLPSVAVPHGFRGSLFPYVLHSIHHALRDVAEPAPTTVGYPWGGRNAAYTDVVGCFMNTVVSLDTPGCPRSPDPTGDFLRNWYRELDHADVPFTAVTALGSTFSGAVSAMLSYTHAGPPTVDVAGVPAVEVTPSRSEPPSMCGLLAGVTLHDGELRLRLLLDEENTTYGVRAFGTRWRDRLTSAFSHVPEPKP (hide)

Domain analysis:

Biosynthetic assembly:

E

orf_2923

Domain Start End Score
PLP-dependent aldo-uridine transaminase 1 425 938.3

Detection: predicted by Prodigal
Start: 3382745 | End: 3384023 | Frame: +

Sequence: show MHPSTRTSSLWRPWTPITQQAGSLRIVEALGNRVRDVEGNWYLDGISGVLNASCGHGHPRLIEAATQQLQRLVHYDPMVSSHDPAETLAARLAELLPGDLNETVLLNSGSEATEAALRIALQYWRNLGEHRDRVITFEAAYHGTTFLAQQLSKLPFTVSEWTPPFPIEHVALPAAPRELRTEEGADALIAAFAQALEAGPPAAAVMVEPLLGLGGCVVLPAGFLARLRELCDRHGALLILDEVFCGFGRTGRMFGFEHEGITPDLVTMSKGISGGYVPLAAVTVTSRIKETFVREPVAQGLRYGHTTGGHAVASAVGNTVLDVMTDEKLVENAAAQGNALLEGLRKLEASPLITDVRGLGLVVAIEADTPESAAAIAEASAQAGVMTRAERGVIRIAPPLTLTDDDTAEAVAKISGAVDVALAR (hide)

Domain analysis:

Biosynthetic assembly:

Pac5

orf_2927

Domain Start End Score
Adenylation+ 24 424 351.8
Methionine 10 400 663.3
Threonine 23 400 393.9
Serine 23 400 371.5
Phenylalanine 23 400 368.8
Tryptophan 23 400 362.5
Glutamate 23 400 361.3
Lysine 23 400 358.3
Threonine 23 400 348.7
Leucine 23 400 345.5
Hydroxyglutamine 4 400 108.6

Detection: predicted by Prodigal
Start: 3387330 | End: 3388911 | Frame: -

Sequence: show MRAAMTTAEQRSLLDTAVSLPDLFRAVAAARGAAPALRDGARTLSYRELDDLTDRIAARLAAEGVRPGDRVGILLPRSAETQISILAVLKAGAAYVPLDPSYPAERLRFLVRDAEIRVVVGDAGHFAASGLKDVRVLAPEAEETIPPAPPVPLDGSELAYVIYTSGSTGTPKGCMVQHTSVLELVRGVMSVVDLDTEDRVALFLPFIFDGSVLQFWLSLAAGATAVVVPSRVAQSMPDFLDLLRREAVTLVIQVPTTLRALAHAHEEAGRPPLALRYVLVGGESIELDVVSAFLARCPGTPPEVVNIYGPTEATCVATCRVLTQEDFDGPVRSPIGTALPHLLVEVRGEAMEPVPDGEVGELVIAGSGVAMGYLGRPELTAERFVVLDTPQGPVRYYRTGDLARRLPDGAFAYLGRNDQQVKVGIRVELGEVETYLRAHPVVREAAATVVDTQAGAQFLTACVVLADQAPEKPEALLRQHMLASLPPFMAPDRYQFVPELPLTDSGKLDRRAVHDMATPRRAPRP (hide)

Domain analysis:

Biosynthetic assembly:

Met